BLASTX nr result
ID: Atractylodes22_contig00034836
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00034836 (581 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003541311.1| PREDICTED: uncharacterized protein LOC100787... 57 2e-06 >ref|XP_003541311.1| PREDICTED: uncharacterized protein LOC100787066 [Glycine max] Length = 229 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/44 (52%), Positives = 27/44 (61%), Gaps = 5/44 (11%) Frame = +3 Query: 93 KKTRKSCGFWKWLCGNSCFNMSWV-----XXXXXXXSLQTPRCC 209 KK R+SCGFWKWLCG CFN+SW+ L+ PRCC Sbjct: 91 KKNRRSCGFWKWLCGMPCFNLSWICCCCCCCEGLSLQLKLPRCC 134