BLASTX nr result
ID: Atractylodes22_contig00034618
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00034618 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI36613.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_002270621.1| PREDICTED: uncharacterized protein LOC100258... 59 5e-07 >emb|CBI36613.3| unnamed protein product [Vitis vinifera] Length = 126 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +1 Query: 136 MHTSSPLKKEFLKKWIEGLQICCSSKKQMNLMERKKKIKL 255 M + LKKEFLKKWI GLQ+C SSKK+M+ +ERKK IKL Sbjct: 1 MRPPTSLKKEFLKKWIMGLQLCSSSKKEMSFLERKKAIKL 40 >ref|XP_002270621.1| PREDICTED: uncharacterized protein LOC100258663 [Vitis vinifera] Length = 185 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +1 Query: 136 MHTSSPLKKEFLKKWIEGLQICCSSKKQMNLMERKKKIKL 255 M + LKKEFLKKWI GLQ+C SSKK+M+ +ERKK IKL Sbjct: 1 MRPPTSLKKEFLKKWIMGLQLCSSSKKEMSFLERKKAIKL 40