BLASTX nr result
ID: Atractylodes22_contig00033321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00033321 (219 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004156554.1| PREDICTED: LOW QUALITY PROTEIN: GTP-binding ... 62 5e-08 ref|XP_004137207.1| PREDICTED: GTP-binding protein At3g49725, ch... 62 5e-08 ref|XP_002263978.2| PREDICTED: GTP-binding protein At3g49725, ch... 60 2e-07 emb|CBI25886.3| unnamed protein product [Vitis vinifera] 60 2e-07 emb|CAN74733.1| hypothetical protein VITISV_037839 [Vitis vinifera] 60 2e-07 >ref|XP_004156554.1| PREDICTED: LOW QUALITY PROTEIN: GTP-binding protein At3g49725, chloroplastic-like [Cucumis sativus] Length = 631 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -1 Query: 117 NQLLSEIKEVRRTRALQRASRKRHGGSHGQDMPTVAIVG 1 N L S+I+EVRRTR+LQRASRKRHGGS+GQ + TVA+VG Sbjct: 279 NHLYSQIEEVRRTRSLQRASRKRHGGSNGQHLATVAVVG 317 >ref|XP_004137207.1| PREDICTED: GTP-binding protein At3g49725, chloroplastic-like [Cucumis sativus] Length = 593 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -1 Query: 117 NQLLSEIKEVRRTRALQRASRKRHGGSHGQDMPTVAIVG 1 N L S+I+EVRRTR+LQRASRKRHGGS+GQ + TVA+VG Sbjct: 279 NHLYSQIEEVRRTRSLQRASRKRHGGSNGQHLATVAVVG 317 >ref|XP_002263978.2| PREDICTED: GTP-binding protein At3g49725, chloroplastic-like, partial [Vitis vinifera] Length = 555 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 117 NQLLSEIKEVRRTRALQRASRKRHGGSHGQDMPTVAIVG 1 N LLS+I+ VRRTRALQRASRKR GGS+GQ + TVAIVG Sbjct: 228 NHLLSQIEAVRRTRALQRASRKRRGGSNGQGLATVAIVG 266 >emb|CBI25886.3| unnamed protein product [Vitis vinifera] Length = 580 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 117 NQLLSEIKEVRRTRALQRASRKRHGGSHGQDMPTVAIVG 1 N LLS+I+ VRRTRALQRASRKR GGS+GQ + TVAIVG Sbjct: 292 NHLLSQIEAVRRTRALQRASRKRRGGSNGQGLATVAIVG 330 >emb|CAN74733.1| hypothetical protein VITISV_037839 [Vitis vinifera] Length = 743 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 117 NQLLSEIKEVRRTRALQRASRKRHGGSHGQDMPTVAIVG 1 N LLS+I+ VRRTRALQRASRKR GGS+GQ + TVAIVG Sbjct: 433 NHLLSQIEAVRRTRALQRASRKRRGGSNGQGLATVAIVG 471