BLASTX nr result
ID: Atractylodes22_contig00030447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00030447 (386 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC33961.1| contains similarity to reverse trancriptase (Pfam... 57 1e-06 >gb|AAC33961.1| contains similarity to reverse trancriptase (Pfam: rvt.hmm, score: 42.57) [Arabidopsis thaliana] Length = 1662 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 1/67 (1%) Frame = -2 Query: 382 IIPRKVNILIWRIHKKGIPVREKIHERGIDLDSRLRPRCTNDQESLHHCFLQCPYSALVW 203 IIP K+ ++WR K +P R ++ RG+D+D PRC ++E+++H CPY+A +W Sbjct: 1367 IIP-KIKYMLWRTISKALPTRSRLLTRGMDIDPHC-PRCPTEEETINHVLFTCPYAASIW 1424 Query: 202 KVI-FAW 185 + F W Sbjct: 1425 GLSNFPW 1431