BLASTX nr result
ID: Atractylodes22_contig00027146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00027146 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002882511.1| structural constituent of ribosome [Arabidop... 56 3e-06 ref|XP_002865669.1| 60S ribosomal protein L13A [Arabidopsis lyra... 55 8e-06 ref|XP_002863167.1| predicted protein [Arabidopsis lyrata subsp.... 55 8e-06 dbj|BAF01678.1| 60S ribosomal protein L13a [Arabidopsis thaliana] 55 8e-06 ref|NP_199687.1| 60S ribosomal protein L13a-4 [Arabidopsis thali... 55 8e-06 >ref|XP_002882511.1| structural constituent of ribosome [Arabidopsis lyrata subsp. lyrata] gi|297328351|gb|EFH58770.1| structural constituent of ribosome [Arabidopsis lyrata subsp. lyrata] Length = 207 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 244 KQLNKLRAKAEKVAEEKLGAQLEILAPVTY 155 KQLNKLRAKAEKVAEEKLG+QLE+LAPV Y Sbjct: 178 KQLNKLRAKAEKVAEEKLGSQLEVLAPVKY 207 >ref|XP_002865669.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata] gi|297311504|gb|EFH41928.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata] Length = 206 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 244 KQLNKLRAKAEKVAEEKLGAQLEILAPVTY 155 KQLNKLR KAEKVAEEKLGAQL+ILAPV Y Sbjct: 177 KQLNKLRVKAEKVAEEKLGAQLDILAPVKY 206 >ref|XP_002863167.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297309001|gb|EFH39426.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 206 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 244 KQLNKLRAKAEKVAEEKLGAQLEILAPVTY 155 KQLNKLRAKAEKVAEEKLG+QL++LAPV Y Sbjct: 177 KQLNKLRAKAEKVAEEKLGSQLDVLAPVKY 206 >dbj|BAF01678.1| 60S ribosomal protein L13a [Arabidopsis thaliana] Length = 41 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 244 KQLNKLRAKAEKVAEEKLGAQLEILAPVTY 155 KQLNKLR KAEKVAEEKLGAQL+ILAPV Y Sbjct: 12 KQLNKLRVKAEKVAEEKLGAQLDILAPVKY 41 >ref|NP_199687.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana] gi|145334783|ref|NP_001078737.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana] gi|17865558|sp|Q9FKC0.1|R13A4_ARATH RecName: Full=60S ribosomal protein L13a-4 gi|9758875|dbj|BAB09429.1| 60S ribosomal protein L13a [Arabidopsis thaliana] gi|19699305|gb|AAL91263.1| AT5g48760/K24G6_9 [Arabidopsis thaliana] gi|21593767|gb|AAM65734.1| 60S ribosomal protein L13a [Arabidopsis thaliana] gi|21689627|gb|AAM67435.1| At5g48760/K24G6_9 [Arabidopsis thaliana] gi|332008337|gb|AED95720.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana] gi|332008338|gb|AED95721.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana] Length = 206 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 244 KQLNKLRAKAEKVAEEKLGAQLEILAPVTY 155 KQLNKLR KAEKVAEEKLGAQL+ILAPV Y Sbjct: 177 KQLNKLRVKAEKVAEEKLGAQLDILAPVKY 206