BLASTX nr result
ID: Atractylodes22_contig00025300
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00025300 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533299.1| 14 kDa proline-rich protein DC2.15 precursor... 65 6e-09 ref|NP_001233824.1| arachidonic acid-induced DEA1 precursor [Sol... 65 7e-09 dbj|BAF46299.1| extensin like protein [Ipomoea nil] 64 1e-08 gb|ABQ88334.1| lipid transfer protein [Capsicum annuum] 63 3e-08 emb|CAI51313.1| arachidonic acid-induced DEA1 [Capsicum chinense] 63 3e-08 >ref|XP_002533299.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus communis] gi|223526883|gb|EEF29093.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus communis] Length = 133 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 309 CTAIKANLLGINLNVPLSIGLLLNACGIKNPSGFKC 202 CTAIKAN+LGINLN+PLS+ LLLN CG K PSGF+C Sbjct: 97 CTAIKANILGINLNIPLSLSLLLNVCGKKTPSGFQC 132 >ref|NP_001233824.1| arachidonic acid-induced DEA1 precursor [Solanum lycopersicum] gi|46095207|gb|AAS80139.1| arachidonic acid-induced DEA1 [Solanum lycopersicum] Length = 138 Score = 64.7 bits (156), Expect = 7e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 309 CTAIKANLLGINLNVPLSIGLLLNACGIKNPSGFKC 202 CTAIKAN+LGINLNVPLS+ LLLN CG K PSGF+C Sbjct: 101 CTAIKANILGINLNVPLSLSLLLNVCGKKAPSGFQC 136 >dbj|BAF46299.1| extensin like protein [Ipomoea nil] Length = 133 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 309 CTAIKANLLGINLNVPLSIGLLLNACGIKNPSGFKC 202 CTAIKAN+LGINLNVPLS+ LLLN CG K PSGF+C Sbjct: 97 CTAIKANILGINLNVPLSLSLLLNVCGKKVPSGFQC 132 >gb|ABQ88334.1| lipid transfer protein [Capsicum annuum] Length = 142 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -2 Query: 309 CTAIKANLLGINLNVPLSIGLLLNACGIKNPSGFKC 202 CTA+KAN+LGINLNVP+S+ LLLN CG K PSGF+C Sbjct: 105 CTALKANILGINLNVPISLSLLLNVCGKKVPSGFQC 140 >emb|CAI51313.1| arachidonic acid-induced DEA1 [Capsicum chinense] Length = 142 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -2 Query: 309 CTAIKANLLGINLNVPLSIGLLLNACGIKNPSGFKC 202 CTA+KAN+LGINLNVP+S+ LLLN CG K PSGF+C Sbjct: 105 CTALKANILGINLNVPISLSLLLNVCGKKVPSGFQC 140