BLASTX nr result
ID: Atractylodes22_contig00025048
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00025048 (221 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA88921.1| sigma factor [Nicotiana tabacum] 55 8e-06 >dbj|BAA88921.1| sigma factor [Nicotiana tabacum] Length = 508 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -2 Query: 115 MMATTAVVGLRAGKRLLGSSLYYSDVSDKLSCSSD 11 MM+T AV+GL AGKRLL SS YYSD+++KL+C+SD Sbjct: 1 MMSTAAVIGLSAGKRLLSSSFYYSDLNEKLTCTSD 35