BLASTX nr result
ID: Atractylodes22_contig00022441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00022441 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM48133.1|AF509338_1 putative flavanone 3-hydroxylase [Sauss... 57 1e-06 >gb|AAM48133.1|AF509338_1 putative flavanone 3-hydroxylase [Saussurea medusa] gi|48431269|gb|AAT44124.1| F3H-like protein [Saussurea medusa] Length = 343 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -1 Query: 272 KAYQYNDFIADYLAFLRTPLPRNGTPLDPYRL 177 K+YQYN+FIADYLA++R P P +GTPLDPYR+ Sbjct: 312 KSYQYNNFIADYLAYIRKPFPPSGTPLDPYRV 343