BLASTX nr result
ID: Atractylodes22_contig00022099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00022099 (518 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003568632.1| PREDICTED: uncharacterized mitochondrial car... 66 3e-09 ref|XP_003554533.1| PREDICTED: mitochondrial substrate carrier f... 65 4e-09 ref|XP_002439632.1| hypothetical protein SORBIDRAFT_09g017280 [S... 65 7e-09 ref|XP_003591466.1| Mitochondrial folate transporter/carrier [Me... 64 1e-08 ref|XP_002523136.1| mitochondrial carrier protein, putative [Ric... 64 1e-08 >ref|XP_003568632.1| PREDICTED: uncharacterized mitochondrial carrier C227.03c-like [Brachypodium distachyon] Length = 340 Score = 65.9 bits (159), Expect = 3e-09 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 3/83 (3%) Frame = +2 Query: 230 IGGALLI--VMEKRRVRVCRDWKQDHGSGVLSPLDHHQVYFTINEQLQGLLGSD-GNHRL 400 IGG+++I + + R R + VL+ L + VYFT+ EQL+ LL SD G+H+L Sbjct: 74 IGGSVIIGSLQQITRREGFRGLYRGLSPTVLALLPNWAVYFTVYEQLKSLLSSDEGSHQL 133 Query: 401 SIGANMLAASGDGAATTIVTNPL 469 S+GAN++AAS GAATTIVTNPL Sbjct: 134 SVGANVIAASCAGAATTIVTNPL 156 >ref|XP_003554533.1| PREDICTED: mitochondrial substrate carrier family protein W-like [Glycine max] Length = 317 Score = 65.5 bits (158), Expect = 4e-09 Identities = 34/53 (64%), Positives = 41/53 (77%) Frame = +2 Query: 311 VLSPLDHHQVYFTINEQLQGLLGSDGNHRLSIGANMLAASGDGAATTIVTNPL 469 VL+ L + VYF+ EQL+ LL SD +H LSIGANM+AASG GAATT+ TNPL Sbjct: 86 VLALLPNWAVYFSAYEQLKSLLQSDDSHHLSIGANMIAASGAGAATTMFTNPL 138 >ref|XP_002439632.1| hypothetical protein SORBIDRAFT_09g017280 [Sorghum bicolor] gi|241944917|gb|EES18062.1| hypothetical protein SORBIDRAFT_09g017280 [Sorghum bicolor] Length = 340 Score = 64.7 bits (156), Expect = 7e-09 Identities = 35/54 (64%), Positives = 44/54 (81%), Gaps = 1/54 (1%) Frame = +2 Query: 311 VLSPLDHHQVYFTINEQLQGLLGS-DGNHRLSIGANMLAASGDGAATTIVTNPL 469 VL+ L + VYFT+ EQL+ LL S DG+H+LS+GAN++AAS GAATTIVTNPL Sbjct: 104 VLALLPNWAVYFTVYEQLKSLLSSNDGSHQLSLGANVVAASCAGAATTIVTNPL 157 >ref|XP_003591466.1| Mitochondrial folate transporter/carrier [Medicago truncatula] gi|355480514|gb|AES61717.1| Mitochondrial folate transporter/carrier [Medicago truncatula] Length = 379 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/52 (59%), Positives = 42/52 (80%) Frame = +2 Query: 311 VLSPLDHHQVYFTINEQLQGLLGSDGNHRLSIGANMLAASGDGAATTIVTNP 466 VL+ L + +YFT+ EQL+ LL +D +H LS+GAN++AASG GAATT+VTNP Sbjct: 85 VLALLPNWAIYFTMYEQLKRLLSNDESHHLSVGANVVAASGAGAATTMVTNP 136 >ref|XP_002523136.1| mitochondrial carrier protein, putative [Ricinus communis] gi|223537698|gb|EEF39321.1| mitochondrial carrier protein, putative [Ricinus communis] Length = 314 Score = 63.9 bits (154), Expect = 1e-08 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = +2 Query: 311 VLSPLDHHQVYFTINEQLQGLLGSDGNHRLSIGANMLAASGDGAATTIVTNPL 469 VL+ L + VYFT+ EQ + L S+G + LS+GANM+AASG GAATTI TNPL Sbjct: 83 VLALLPNWAVYFTMYEQFKSFLSSNGENHLSVGANMIAASGAGAATTIFTNPL 135