BLASTX nr result
ID: Atractylodes22_contig00021692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00021692 (683 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004149828.1| PREDICTED: sulfate transporter 4.1, chloropl... 118 3e-26 gb|ABK35757.1| sulfate transporter [Populus tremula x Populus alba] 118 2e-25 ref|XP_002533663.1| sulfate transporter, putative [Ricinus commu... 114 1e-24 ref|XP_002282491.2| PREDICTED: probable sulfate transporter 4.2 ... 113 2e-24 emb|CBI31747.3| unnamed protein product [Vitis vinifera] 113 2e-24 >ref|XP_004149828.1| PREDICTED: sulfate transporter 4.1, chloroplastic-like [Cucumis sativus] Length = 700 Score = 118 bits (296), Expect(2) = 3e-26 Identities = 57/95 (60%), Positives = 70/95 (73%) Frame = +1 Query: 1 KELYQEYNSRDIQIAIANPNKEVFLTLAKSGFIDQIGKEWCFVRVHDAVQVCLQHVPTSN 180 K+LYQEY RDIQIAI+NPN++V LT ++SG ++ IGKEW FVRVHDAVQVCLQHV + N Sbjct: 583 KDLYQEYKLRDIQIAISNPNRDVLLTFSRSGVVELIGKEWFFVRVHDAVQVCLQHVESLN 642 Query: 181 NAPKILESSPDKSSRFLERLGTRRKEDLSTSEMES 285 K +SSP S FL+ L R ED S S++ES Sbjct: 643 ETTKTSDSSPKDKSSFLQSLVKSRSEDFSVSQLES 677 Score = 26.2 bits (56), Expect(2) = 3e-26 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 372 DPQLEPLLSRK 404 DPQLEPLLSRK Sbjct: 689 DPQLEPLLSRK 699 >gb|ABK35757.1| sulfate transporter [Populus tremula x Populus alba] Length = 676 Score = 118 bits (296), Expect(2) = 2e-25 Identities = 56/95 (58%), Positives = 72/95 (75%) Frame = +1 Query: 1 KELYQEYNSRDIQIAIANPNKEVFLTLAKSGFIDQIGKEWCFVRVHDAVQVCLQHVPTSN 180 K+L+QEY SRDI+I IANPN++V LTL K+G ++ IGKEW FVRVHDAVQVCLQHV + N Sbjct: 559 KDLHQEYKSRDIEICIANPNQDVLLTLTKAGIVELIGKEWYFVRVHDAVQVCLQHVQSLN 618 Query: 181 NAPKILESSPDKSSRFLERLGTRRKEDLSTSEMES 285 PK +S + F +RL +R+EDLS +E+ES Sbjct: 619 QTPKNPDSFAEDKPSFFQRLSKQREEDLSIAELES 653 Score = 23.1 bits (48), Expect(2) = 2e-25 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +3 Query: 369 SDPQLEPLLSRK 404 ++P LEPLLSRK Sbjct: 664 TEPHLEPLLSRK 675 >ref|XP_002533663.1| sulfate transporter, putative [Ricinus communis] gi|223526445|gb|EEF28722.1| sulfate transporter, putative [Ricinus communis] Length = 654 Score = 114 bits (286), Expect(2) = 1e-24 Identities = 56/95 (58%), Positives = 71/95 (74%) Frame = +1 Query: 1 KELYQEYNSRDIQIAIANPNKEVFLTLAKSGFIDQIGKEWCFVRVHDAVQVCLQHVPTSN 180 K+L+ EY SRDIQIAI+NPN+EV L+L K+G +D IGKEW FVRVHDAVQVCLQHV + N Sbjct: 537 KDLHHEYKSRDIQIAISNPNREVLLSLMKAGLMDLIGKEWYFVRVHDAVQVCLQHVQSLN 596 Query: 181 NAPKILESSPDKSSRFLERLGTRRKEDLSTSEMES 285 PK + S D S F RL ++++D S S++ES Sbjct: 597 QPPKRPDPSLDDKSSFFRRLLKQKEDDSSVSDLES 631 Score = 24.6 bits (52), Expect(2) = 1e-24 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +3 Query: 369 SDPQLEPLLSRK 404 +DP LEPLLSRK Sbjct: 642 TDPHLEPLLSRK 653 >ref|XP_002282491.2| PREDICTED: probable sulfate transporter 4.2 [Vitis vinifera] Length = 706 Score = 113 bits (283), Expect(2) = 2e-24 Identities = 55/95 (57%), Positives = 68/95 (71%) Frame = +1 Query: 1 KELYQEYNSRDIQIAIANPNKEVFLTLAKSGFIDQIGKEWCFVRVHDAVQVCLQHVPTSN 180 K+LY EY SRDIQIAI+NPN+EV LTLAK+ ++ IGKEW FVRVHDAVQVCLQHV + N Sbjct: 589 KDLYHEYKSRDIQIAISNPNREVLLTLAKANLVELIGKEWYFVRVHDAVQVCLQHVQSIN 648 Query: 181 NAPKILESSPDKSSRFLERLGTRRKEDLSTSEMES 285 K E + +RL +R+ED S +E+ES Sbjct: 649 EGAKTAEPLEEDKPSLFQRLLKQRREDFSKAELES 683 Score = 24.6 bits (52), Expect(2) = 2e-24 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 369 SDPQLEPLLSRK 404 SD QLEPLLSRK Sbjct: 694 SDSQLEPLLSRK 705 >emb|CBI31747.3| unnamed protein product [Vitis vinifera] Length = 681 Score = 113 bits (283), Expect(2) = 2e-24 Identities = 55/95 (57%), Positives = 68/95 (71%) Frame = +1 Query: 1 KELYQEYNSRDIQIAIANPNKEVFLTLAKSGFIDQIGKEWCFVRVHDAVQVCLQHVPTSN 180 K+LY EY SRDIQIAI+NPN+EV LTLAK+ ++ IGKEW FVRVHDAVQVCLQHV + N Sbjct: 564 KDLYHEYKSRDIQIAISNPNREVLLTLAKANLVELIGKEWYFVRVHDAVQVCLQHVQSIN 623 Query: 181 NAPKILESSPDKSSRFLERLGTRRKEDLSTSEMES 285 K E + +RL +R+ED S +E+ES Sbjct: 624 EGAKTAEPLEEDKPSLFQRLLKQRREDFSKAELES 658 Score = 24.6 bits (52), Expect(2) = 2e-24 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 369 SDPQLEPLLSRK 404 SD QLEPLLSRK Sbjct: 669 SDSQLEPLLSRK 680