BLASTX nr result
ID: Atractylodes22_contig00020413
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00020413 (577 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540663.1| PREDICTED: diphthamide biosynthesis protein ... 62 7e-08 ref|XP_003533490.1| PREDICTED: diphthamide biosynthesis protein ... 61 1e-07 ref|XP_002454772.1| hypothetical protein SORBIDRAFT_04g037060 [S... 56 4e-06 >ref|XP_003540663.1| PREDICTED: diphthamide biosynthesis protein 1-like [Glycine max] Length = 459 Score = 62.0 bits (149), Expect = 7e-08 Identities = 30/53 (56%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = -2 Query: 576 NSDCNVGADCCGKSKTCCGNNNGIGLKGVGEDVV-DYPMDYYAQDGGEWNSCY 421 N C G CC KS +CC + G GED DYPMDYYAQDGGEWNS Y Sbjct: 391 NEVCEEGEGCCNKSGSCCEDAKG------GEDFGGDYPMDYYAQDGGEWNSSY 437 >ref|XP_003533490.1| PREDICTED: diphthamide biosynthesis protein 1-like [Glycine max] Length = 467 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/44 (65%), Positives = 31/44 (70%), Gaps = 1/44 (2%) Frame = -2 Query: 549 CCGKSKTCCGNNNGIGLKGVGEDVV-DYPMDYYAQDGGEWNSCY 421 CC KS +CCG+ KG GED DYPMDYYAQDGGEWNS Y Sbjct: 401 CCNKSGSCCGD-----AKGGGEDFGGDYPMDYYAQDGGEWNSSY 439 >ref|XP_002454772.1| hypothetical protein SORBIDRAFT_04g037060 [Sorghum bicolor] gi|241934603|gb|EES07748.1| hypothetical protein SORBIDRAFT_04g037060 [Sorghum bicolor] Length = 487 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/46 (58%), Positives = 31/46 (67%) Frame = -2 Query: 558 GADCCGKSKTCCGNNNGIGLKGVGEDVVDYPMDYYAQDGGEWNSCY 421 G+ CC S TC GN N G G+ DYPMDYY+QDGG+WNSCY Sbjct: 406 GSGCCSGSGTC-GNCNCSG----GDFGGDYPMDYYSQDGGDWNSCY 446