BLASTX nr result
ID: Atractylodes22_contig00018882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00018882 (350 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275694.1| PREDICTED: snakin-2 isoform 1 [Vitis vinifer... 80 2e-13 gb|ABL74292.1| snakin 2 [Solanum tuberosum] 79 4e-13 sp|Q93X17.1|SNAK2_SOLTU RecName: Full=Snakin-2; Flags: Precursor... 79 4e-13 gb|AGE15497.1| GA-stimulated transcript-like protein 1 [Gossypiu... 78 9e-13 emb|CAC44011.1| snakin2 [Solanum tuberosum] 76 3e-12 >ref|XP_002275694.1| PREDICTED: snakin-2 isoform 1 [Vitis vinifera] gi|302142658|emb|CBI19861.3| unnamed protein product [Vitis vinifera] Length = 98 Score = 80.1 bits (196), Expect = 2e-13 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +1 Query: 244 KMDCGGACAARCKLSKRPNLCNRACGTCCGRCNCV 348 KMDCGGAC+ARC+LS RPNLCNRACGTCC RCNCV Sbjct: 37 KMDCGGACSARCRLSSRPNLCNRACGTCCARCNCV 71 >gb|ABL74292.1| snakin 2 [Solanum tuberosum] Length = 94 Score = 79.0 bits (193), Expect = 4e-13 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 232 YTPAKMDCGGACAARCKLSKRPNLCNRACGTCCGRCNCV 348 Y+ K+DCGGACAARC+LS RP LCNRACGTCC RCNCV Sbjct: 39 YSYKKIDCGGACAARCRLSSRPRLCNRACGTCCARCNCV 77 >sp|Q93X17.1|SNAK2_SOLTU RecName: Full=Snakin-2; Flags: Precursor gi|14625945|emb|CAC44012.1| snakin2 [Solanum tuberosum] gi|308535464|gb|ACF74550.2| snakin-2 [Solanum tuberosum] gi|308535465|gb|ACF74551.2| snakin-2 [Solanum tuberosum] gi|308535466|gb|ACF74552.2| snakin-2 [Solanum tuberosum] gi|332715320|gb|AEE98996.1| snakin-2 [Solanum tuberosum] Length = 104 Score = 79.0 bits (193), Expect = 4e-13 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 232 YTPAKMDCGGACAARCKLSKRPNLCNRACGTCCGRCNCV 348 Y+ K+DCGGACAARC+LS RP LCNRACGTCC RCNCV Sbjct: 39 YSYKKIDCGGACAARCRLSSRPRLCNRACGTCCARCNCV 77 >gb|AGE15497.1| GA-stimulated transcript-like protein 1 [Gossypium hirsutum] Length = 102 Score = 77.8 bits (190), Expect = 9e-13 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 238 PAKMDCGGACAARCKLSKRPNLCNRACGTCCGRCNCV 348 P K+DCGGACAARC+LS RP+LC RACGTCC RCNCV Sbjct: 39 PKKIDCGGACAARCRLSSRPHLCKRACGTCCARCNCV 75 >emb|CAC44011.1| snakin2 [Solanum tuberosum] Length = 104 Score = 76.3 bits (186), Expect = 3e-12 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +1 Query: 232 YTPAKMDCGGACAARCKLSKRPNLCNRACGTCCGRCNCV 348 Y+ K+ CGGACAARC+LS RP LCNRACGTCC RCNCV Sbjct: 39 YSYKKIGCGGACAARCRLSSRPRLCNRACGTCCARCNCV 77