BLASTX nr result
ID: Atractylodes22_contig00018666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00018666 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACY69610.1| TIR-NBS-LRR resistance-like protein RGC151 [Helia... 80 1e-13 >gb|ACY69610.1| TIR-NBS-LRR resistance-like protein RGC151 [Helianthus annuus] Length = 1021 Score = 80.5 bits (197), Expect = 1e-13 Identities = 37/69 (53%), Positives = 50/69 (72%) Frame = -3 Query: 208 ITTKDASLTQRSELFNPIVQPKHTKHLLRGLYEYDSLKLLCFHAFKCNGPKEGYNEVSQT 29 IT+K+ SLT++ +LF V PKHTKHLL GL + DSL+LL HAF C+ P EG + + Sbjct: 339 ITSKNGSLTEKCKLFETQVPPKHTKHLLHGLNDKDSLQLLTCHAFGCHEPNEGDKKEMKK 398 Query: 28 LVKYCEGHP 2 +V+YC+GHP Sbjct: 399 VVQYCKGHP 407