BLASTX nr result
ID: Atractylodes22_contig00017723
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00017723 (215 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145344.1| PREDICTED: mitochondrial import receptor sub... 87 1e-15 ref|XP_002305407.1| predicted protein [Populus trichocarpa] gi|1... 86 2e-15 ref|NP_564545.1| mitochondrial import receptor subunit TOM6-like... 86 4e-15 ref|XP_002519115.1| conserved hypothetical protein [Ricinus comm... 85 7e-15 ref|XP_002894180.1| hypothetical protein ARALYDRAFT_891816 [Arab... 84 9e-15 >ref|XP_004145344.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449455208|ref|XP_004145345.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474805|ref|XP_004154290.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474809|ref|XP_004154291.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532212|ref|XP_004173076.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532214|ref|XP_004173077.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] Length = 54 Score = 87.0 bits (214), Expect = 1e-15 Identities = 40/48 (83%), Positives = 41/48 (85%) Frame = -3 Query: 144 MFPGMFMRKPDKEAALKQLRVHVAWFGTWVVVIRVTPYVLHYFSDSKD 1 MFPGMFMRKPDK AALKQLR HVA FG WV VIRVTPYVLHY SD K+ Sbjct: 1 MFPGMFMRKPDKAAALKQLRSHVAMFGVWVAVIRVTPYVLHYLSDEKE 48 >ref|XP_002305407.1| predicted protein [Populus trichocarpa] gi|118484423|gb|ABK94088.1| unknown [Populus trichocarpa] gi|222848371|gb|EEE85918.1| predicted protein [Populus trichocarpa] Length = 54 Score = 86.3 bits (212), Expect = 2e-15 Identities = 39/48 (81%), Positives = 41/48 (85%) Frame = -3 Query: 144 MFPGMFMRKPDKEAALKQLRVHVAWFGTWVVVIRVTPYVLHYFSDSKD 1 MFPGMFMRKPDK ALKQL+ HVA FG WVVV+RVTPYVLHY SD KD Sbjct: 1 MFPGMFMRKPDKAEALKQLKSHVAMFGAWVVVLRVTPYVLHYLSDEKD 48 >ref|NP_564545.1| mitochondrial import receptor subunit TOM6-like protein [Arabidopsis thaliana] gi|46577137|sp|Q9XIA7.1|TOM6_ARATH RecName: Full=Mitochondrial import receptor subunit TOM6 homolog; AltName: Full=Translocase of outer membrane 6 kDa subunit homolog gi|5430759|gb|AAD43159.1|AC007504_14 Unknown Protein [Arabidopsis thaliana] gi|11692924|gb|AAG40065.1|AF324714_1 At1g49410 [Arabidopsis thaliana] gi|11762280|gb|AAG40411.1|AF325059_1 At1g49410 [Arabidopsis thaliana] gi|11935199|gb|AAG42015.1|AF327425_1 unknown protein [Arabidopsis thaliana] gi|12642920|gb|AAK00402.1|AF339720_1 unknown protein [Arabidopsis thaliana] gi|14335020|gb|AAK59774.1| At1g49410/F13F21_16 [Arabidopsis thaliana] gi|27363338|gb|AAO11588.1| At1g49410/F13F21_16 [Arabidopsis thaliana] gi|332194306|gb|AEE32427.1| mitochondrial import receptor subunit TOM6-like protein [Arabidopsis thaliana] Length = 54 Score = 85.5 bits (210), Expect = 4e-15 Identities = 39/48 (81%), Positives = 41/48 (85%) Frame = -3 Query: 144 MFPGMFMRKPDKEAALKQLRVHVAWFGTWVVVIRVTPYVLHYFSDSKD 1 MFPGMFMRKPDK ALKQLR HVA FG+WVV+IR PYVL YFSDSKD Sbjct: 1 MFPGMFMRKPDKAEALKQLRTHVALFGSWVVIIRAAPYVLSYFSDSKD 48 >ref|XP_002519115.1| conserved hypothetical protein [Ricinus communis] gi|223541778|gb|EEF43326.1| conserved hypothetical protein [Ricinus communis] Length = 54 Score = 84.7 bits (208), Expect = 7e-15 Identities = 38/48 (79%), Positives = 40/48 (83%) Frame = -3 Query: 144 MFPGMFMRKPDKEAALKQLRVHVAWFGTWVVVIRVTPYVLHYFSDSKD 1 MFPGMFMRKPDK AALKQL+ H A FG WV +IRVTPYVLHY SD KD Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHAAIFGAWVALIRVTPYVLHYLSDDKD 48 >ref|XP_002894180.1| hypothetical protein ARALYDRAFT_891816 [Arabidopsis lyrata subsp. lyrata] gi|297340022|gb|EFH70439.1| hypothetical protein ARALYDRAFT_891816 [Arabidopsis lyrata subsp. lyrata] Length = 54 Score = 84.3 bits (207), Expect = 9e-15 Identities = 38/48 (79%), Positives = 40/48 (83%) Frame = -3 Query: 144 MFPGMFMRKPDKEAALKQLRVHVAWFGTWVVVIRVTPYVLHYFSDSKD 1 MFPGMFMRKPDK ALKQLR HVA FG WVV++R PYVL YFSDSKD Sbjct: 1 MFPGMFMRKPDKAVALKQLRTHVALFGGWVVIVRAVPYVLSYFSDSKD 48