BLASTX nr result
ID: Atractylodes22_contig00017582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00017582 (431 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533989.1| ring finger protein, putative [Ricinus commu... 61 1e-07 >ref|XP_002533989.1| ring finger protein, putative [Ricinus communis] gi|223526024|gb|EEF28396.1| ring finger protein, putative [Ricinus communis] Length = 495 Score = 60.8 bits (146), Expect = 1e-07 Identities = 35/78 (44%), Positives = 44/78 (56%), Gaps = 3/78 (3%) Frame = -3 Query: 225 LSPYERPYFFSQXXXXXP---LIPATGFGSNLNNKVSPSVXXXXXXXXXXXXXXXXLHLL 55 LSP ++PYF SQ L ++ G NLN+K+SPSV LHLL Sbjct: 14 LSPSQQPYFLSQPPPQQQNNNLDGSSSDGFNLNSKISPSVLLIIIILAIIFFVSGLLHLL 73 Query: 54 VRFLVKPSNRDPDEFDNV 1 VRFL++P NRDPD+ DNV Sbjct: 74 VRFLLRPPNRDPDDLDNV 91