BLASTX nr result
ID: Atractylodes22_contig00010700
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00010700 (373 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAN34791.1| Grp94 [Xerophyta viscosa] 64 2e-08 ref|NP_974606.1| endoplasmin-like protein [Arabidopsis thaliana]... 62 5e-08 dbj|BAB86368.1| SHEPHERD [Arabidopsis thaliana] 62 5e-08 ref|XP_002867677.1| hypothetical protein ARALYDRAFT_492441 [Arab... 62 5e-08 dbj|BAD94659.1| HSP90-like protein [Arabidopsis thaliana] 62 5e-08 >gb|AAN34791.1| Grp94 [Xerophyta viscosa] Length = 812 Score = 63.5 bits (153), Expect = 2e-08 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +2 Query: 272 RKAESMSRKSLRSNAEKFEFQAEVSRLMDIIINS 373 R+AESMSRK+LRSNAEKFEFQAEVSRLMDIIINS Sbjct: 67 REAESMSRKNLRSNAEKFEFQAEVSRLMDIIINS 100 >ref|NP_974606.1| endoplasmin-like protein [Arabidopsis thaliana] gi|332659462|gb|AEE84862.1| endoplasmin-like protein [Arabidopsis thaliana] Length = 823 Score = 62.0 bits (149), Expect = 5e-08 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = +2 Query: 227 VGEGRSIYNNMKVFIRKAESMSRKSLRSNAEKFEFQAEVSRLMDIIINS 373 +G + + V R++ESMS+K+LRSNAEKFEFQAEVSRLMDIIINS Sbjct: 47 IGGHGGLSTDSDVVHRESESMSKKTLRSNAEKFEFQAEVSRLMDIIINS 95 >dbj|BAB86368.1| SHEPHERD [Arabidopsis thaliana] Length = 823 Score = 62.0 bits (149), Expect = 5e-08 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = +2 Query: 227 VGEGRSIYNNMKVFIRKAESMSRKSLRSNAEKFEFQAEVSRLMDIIINS 373 +G + + V R++ESMS+K+LRSNAEKFEFQAEVSRLMDIIINS Sbjct: 47 IGGHGGLSTDSDVVHRESESMSKKTLRSNAEKFEFQAEVSRLMDIIINS 95 >ref|XP_002867677.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. lyrata] gi|297313513|gb|EFH43936.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. lyrata] Length = 823 Score = 62.0 bits (149), Expect = 5e-08 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = +2 Query: 227 VGEGRSIYNNMKVFIRKAESMSRKSLRSNAEKFEFQAEVSRLMDIIINS 373 +G + + V R++ESMS+K+LRSNAEKFEFQAEVSRLMDIIINS Sbjct: 47 IGGHGGLSTDSDVVHRESESMSKKTLRSNAEKFEFQAEVSRLMDIIINS 95 >dbj|BAD94659.1| HSP90-like protein [Arabidopsis thaliana] Length = 328 Score = 62.0 bits (149), Expect = 5e-08 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = +2 Query: 227 VGEGRSIYNNMKVFIRKAESMSRKSLRSNAEKFEFQAEVSRLMDIIINS 373 +G + + V R++ESMS+K+LRSNAEKFEFQAEVSRLMDIIINS Sbjct: 47 IGGHGGLSTDSDVVHRESESMSKKTLRSNAEKFEFQAEVSRLMDIIINS 95