BLASTX nr result
ID: Atractylodes22_contig00005439
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00005439 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282694.1| PREDICTED: probable cytosolic iron-sulfur pr... 81 1e-13 ref|XP_002528743.1| WD-repeat protein, putative [Ricinus communi... 79 5e-13 ref|XP_002299788.1| predicted protein [Populus trichocarpa] gi|2... 78 9e-13 ref|XP_002878917.1| EMB1345 [Arabidopsis lyrata subsp. lyrata] g... 76 3e-12 ref|NP_565615.1| transducin/WD-40 repeat-containing protein [Ara... 73 2e-11 >ref|XP_002282694.1| PREDICTED: probable cytosolic iron-sulfur protein assembly protein [Vitis vinifera] gi|297740110|emb|CBI30292.3| unnamed protein product [Vitis vinifera] Length = 344 Score = 80.9 bits (198), Expect = 1e-13 Identities = 40/54 (74%), Positives = 45/54 (83%) Frame = +3 Query: 3 SEDHSVDGASYKLLLKKEKAHAMDVNSVQWSSVGNGLLASASDDGTIKIWKLES 164 S+D VDG YKL+LKKE+AH MD+NSVQWSS N LLASASDDGTIKIW+L S Sbjct: 289 SKDGLVDGPLYKLMLKKEQAHDMDINSVQWSSGENRLLASASDDGTIKIWELAS 342 >ref|XP_002528743.1| WD-repeat protein, putative [Ricinus communis] gi|223531837|gb|EEF33655.1| WD-repeat protein, putative [Ricinus communis] Length = 349 Score = 78.6 bits (192), Expect = 5e-13 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = +3 Query: 3 SEDHSVDGASYKLLLKKEKAHAMDVNSVQWSSVGNGLLASASDDGTIKIWKL 158 S+D V+G SY+LLLKKEKAH MD+NSVQW+ N LLASASDDGTIKIW+L Sbjct: 294 SKDDLVNGPSYRLLLKKEKAHDMDINSVQWAPGENRLLASASDDGTIKIWEL 345 >ref|XP_002299788.1| predicted protein [Populus trichocarpa] gi|222847046|gb|EEE84593.1| predicted protein [Populus trichocarpa] Length = 323 Score = 77.8 bits (190), Expect = 9e-13 Identities = 37/51 (72%), Positives = 41/51 (80%) Frame = +3 Query: 3 SEDHSVDGASYKLLLKKEKAHAMDVNSVQWSSVGNGLLASASDDGTIKIWK 155 S+D VDG SYKLLLK+EKAH MD+NSVQW GLLAS SDDGTIKIW+ Sbjct: 273 SKDGLVDGPSYKLLLKREKAHEMDINSVQWGPGETGLLASTSDDGTIKIWE 323 >ref|XP_002878917.1| EMB1345 [Arabidopsis lyrata subsp. lyrata] gi|297324756|gb|EFH55176.1| EMB1345 [Arabidopsis lyrata subsp. lyrata] Length = 352 Score = 75.9 bits (185), Expect = 3e-12 Identities = 39/53 (73%), Positives = 42/53 (79%), Gaps = 1/53 (1%) Frame = +3 Query: 3 SEDHSVDGASYKLLLKKEKAHAMDVNSVQWS-SVGNGLLASASDDGTIKIWKL 158 S+D SVDG SY LLLKK KAH DVNSVQWS GN LLASASDDG +KIW+L Sbjct: 296 SKDDSVDGPSYNLLLKKNKAHENDVNSVQWSPGEGNRLLASASDDGMVKIWQL 348 >ref|NP_565615.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana] gi|20197268|gb|AAC31230.2| expressed protein [Arabidopsis thaliana] gi|20260510|gb|AAM13153.1| unknown protein [Arabidopsis thaliana] gi|21553416|gb|AAM62509.1| unknown [Arabidopsis thaliana] gi|28059424|gb|AAO30057.1| unknown protein [Arabidopsis thaliana] gi|330252696|gb|AEC07790.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana] Length = 352 Score = 73.2 bits (178), Expect = 2e-11 Identities = 38/53 (71%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = +3 Query: 3 SEDHSVDGASYKLLLKKEKAHAMDVNSVQWS-SVGNGLLASASDDGTIKIWKL 158 S+ SVDG SY LLLKK KAH DVNSVQWS GN LLASASDDG +KIW+L Sbjct: 296 SKHDSVDGPSYNLLLKKNKAHENDVNSVQWSPGEGNRLLASASDDGMVKIWQL 348