BLASTX nr result
ID: Atractylodes22_contig00004591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00004591 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633523.1| PREDICTED: putative disease resistance prote... 57 1e-06 >ref|XP_003633523.1| PREDICTED: putative disease resistance protein RGA4-like, partial [Vitis vinifera] Length = 1245 Score = 57.4 bits (137), Expect = 1e-06 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 1/70 (1%) Frame = +1 Query: 13 NCPNGVEKLTIENCSSLTSL-TFELPSTLKFLSLYSCNNLQESCFHNNLLSSLESLYIRD 189 NC +E+L IE CSSLTS + ELPSTLK L +++C NL+ H L+SLE L IR Sbjct: 1027 NC--NLEQLNIEGCSSLTSFPSGELPSTLKHLVIWNCGNLELLPDHLQNLTSLEYLKIRG 1084 Query: 190 WSNLRSFREG 219 +L SF EG Sbjct: 1085 CPSLESFPEG 1094