BLASTX nr result
ID: Atractylodes22_contig00004394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00004394 (447 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518973.1| PREDICTED: subtilisin-like protease-like [Gl... 66 3e-09 emb|CAA07232.1| putative Pi starvation-induced protein [Cicer ar... 64 1e-08 gb|AFK40738.1| unknown [Medicago truncatula] 64 2e-08 ref|XP_003590254.1| Xylem serine proteinase [Medicago truncatula... 64 2e-08 gb|ACU19082.1| unknown [Glycine max] 64 2e-08 >ref|XP_003518973.1| PREDICTED: subtilisin-like protease-like [Glycine max] Length = 136 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = +3 Query: 330 VHIIYTDQPQGDEPESHHLRTLTSVLGSEEAAKGALLYT 446 VHI+YT++PQ +EPE++H+RTLTSVLGSEEAAK ALLY+ Sbjct: 54 VHIVYTERPQNEEPEAYHIRTLTSVLGSEEAAKEALLYS 92 >emb|CAA07232.1| putative Pi starvation-induced protein [Cicer arietinum] Length = 129 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = +3 Query: 330 VHIIYTDQPQGDEPESHHLRTLTSVLGSEEAAKGALLYT 446 VHIIYT+QP +EPE++H+RTLT+VLGSEEAAK ALLY+ Sbjct: 46 VHIIYTEQPHEEEPETYHIRTLTAVLGSEEAAKEALLYS 84 >gb|AFK40738.1| unknown [Medicago truncatula] Length = 130 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = +3 Query: 330 VHIIYTDQPQGDEPESHHLRTLTSVLGSEEAAKGALLYT 446 VHIIYT++P +EPES+H+RTLT+VLGSEEAAK ALLY+ Sbjct: 47 VHIIYTEKPLEEEPESYHIRTLTAVLGSEEAAKDALLYS 85 >ref|XP_003590254.1| Xylem serine proteinase [Medicago truncatula] gi|355479302|gb|AES60505.1| Xylem serine proteinase [Medicago truncatula] gi|388517597|gb|AFK46860.1| unknown [Medicago truncatula] Length = 130 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = +3 Query: 330 VHIIYTDQPQGDEPESHHLRTLTSVLGSEEAAKGALLYT 446 VHIIYT++P +EPES+H+RTLT+VLGSEEAAK ALLY+ Sbjct: 47 VHIIYTEKPLEEEPESYHIRTLTAVLGSEEAAKDALLYS 85 >gb|ACU19082.1| unknown [Glycine max] Length = 136 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/39 (71%), Positives = 36/39 (92%) Frame = +3 Query: 330 VHIIYTDQPQGDEPESHHLRTLTSVLGSEEAAKGALLYT 446 VHI+YT++PQ +EPE++H+RTLTSVLGS EAAK ALLY+ Sbjct: 54 VHIVYTERPQNEEPEAYHIRTLTSVLGSGEAAKEALLYS 92