BLASTX nr result
ID: Atractylodes22_contig00002491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00002491 (451 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632541.1| PREDICTED: probable cation-transporting ATPa... 93 3e-17 emb|CBI27691.3| unnamed protein product [Vitis vinifera] 93 3e-17 ref|XP_002272397.1| PREDICTED: probable cation-transporting ATPa... 93 3e-17 ref|XP_002513245.1| cation-transporting atpase 13a1, putative [R... 89 3e-16 ref|XP_002325729.1| p-type ATPase transporter [Populus trichocar... 89 3e-16 >ref|XP_003632541.1| PREDICTED: probable cation-transporting ATPase-like isoform 2 [Vitis vinifera] Length = 1189 Score = 92.8 bits (229), Expect = 3e-17 Identities = 42/52 (80%), Positives = 46/52 (88%) Frame = +1 Query: 1 VSIMGRGGKEHLSCKRDKNHLLFGGTKILQHTPDKAFHMTTPDGGCLAIVLR 156 VSIMGRG +E LS KRDKNH+LFGGTKILQHTPDK H+ TPDGGCLA+VLR Sbjct: 320 VSIMGRGNEEKLSVKRDKNHVLFGGTKILQHTPDKTVHLKTPDGGCLAVVLR 371 >emb|CBI27691.3| unnamed protein product [Vitis vinifera] Length = 1074 Score = 92.8 bits (229), Expect = 3e-17 Identities = 42/52 (80%), Positives = 46/52 (88%) Frame = +1 Query: 1 VSIMGRGGKEHLSCKRDKNHLLFGGTKILQHTPDKAFHMTTPDGGCLAIVLR 156 VSIMGRG +E LS KRDKNH+LFGGTKILQHTPDK H+ TPDGGCLA+VLR Sbjct: 321 VSIMGRGNEEKLSVKRDKNHVLFGGTKILQHTPDKTVHLKTPDGGCLAVVLR 372 >ref|XP_002272397.1| PREDICTED: probable cation-transporting ATPase-like isoform 1 [Vitis vinifera] Length = 1191 Score = 92.8 bits (229), Expect = 3e-17 Identities = 42/52 (80%), Positives = 46/52 (88%) Frame = +1 Query: 1 VSIMGRGGKEHLSCKRDKNHLLFGGTKILQHTPDKAFHMTTPDGGCLAIVLR 156 VSIMGRG +E LS KRDKNH+LFGGTKILQHTPDK H+ TPDGGCLA+VLR Sbjct: 322 VSIMGRGNEEKLSVKRDKNHVLFGGTKILQHTPDKTVHLKTPDGGCLAVVLR 373 >ref|XP_002513245.1| cation-transporting atpase 13a1, putative [Ricinus communis] gi|223547619|gb|EEF49113.1| cation-transporting atpase 13a1, putative [Ricinus communis] Length = 1193 Score = 89.4 bits (220), Expect = 3e-16 Identities = 40/52 (76%), Positives = 45/52 (86%) Frame = +1 Query: 1 VSIMGRGGKEHLSCKRDKNHLLFGGTKILQHTPDKAFHMTTPDGGCLAIVLR 156 VSIMGRG +E LS KRDK H+LFGGTK+LQHTPDK F + TPDGGCLA+VLR Sbjct: 322 VSIMGRGNEEKLSAKRDKTHVLFGGTKVLQHTPDKTFPLRTPDGGCLAVVLR 373 >ref|XP_002325729.1| p-type ATPase transporter [Populus trichocarpa] gi|222862604|gb|EEF00111.1| p-type ATPase transporter [Populus trichocarpa] Length = 1188 Score = 89.4 bits (220), Expect = 3e-16 Identities = 41/52 (78%), Positives = 45/52 (86%) Frame = +1 Query: 1 VSIMGRGGKEHLSCKRDKNHLLFGGTKILQHTPDKAFHMTTPDGGCLAIVLR 156 VSIMGRG +E LS KRDKNH+LFGGTKILQHTPDK F + PDGGCLA+VLR Sbjct: 321 VSIMGRGTEEKLSAKRDKNHVLFGGTKILQHTPDKTFPLRAPDGGCLAVVLR 372