BLASTX nr result
ID: Atractylodes21_contig00055201
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00055201 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004156889.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosi... 69 3e-10 ref|XP_004152364.1| PREDICTED: beta-glucosidase 11-like [Cucumis... 69 3e-10 ref|XP_002523070.1| beta-glucosidase, putative [Ricinus communis... 63 3e-08 ref|XP_002889423.1| predicted protein [Arabidopsis lyrata subsp.... 62 6e-08 ref|XP_004170794.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosi... 61 8e-08 >ref|XP_004156889.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 11-like, partial [Cucumis sativus] Length = 475 Score = 69.3 bits (168), Expect = 3e-10 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +2 Query: 2 NEANVFTMGGYDSGFTPPGRCSSPFGITNCKDGDSTHEPY 121 NEANVFT+GGYD GF PP RCSSPFG NC G+S+ EPY Sbjct: 177 NEANVFTLGGYDMGFVPPNRCSSPFGTRNCYKGNSSTEPY 216 >ref|XP_004152364.1| PREDICTED: beta-glucosidase 11-like [Cucumis sativus] Length = 578 Score = 69.3 bits (168), Expect = 3e-10 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +2 Query: 2 NEANVFTMGGYDSGFTPPGRCSSPFGITNCKDGDSTHEPY 121 NEANVFT+GGYD GF PP RCSSPFG NC G+S+ EPY Sbjct: 299 NEANVFTLGGYDMGFVPPNRCSSPFGTRNCYKGNSSTEPY 338 >ref|XP_002523070.1| beta-glucosidase, putative [Ricinus communis] gi|223537632|gb|EEF39255.1| beta-glucosidase, putative [Ricinus communis] Length = 500 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = +2 Query: 2 NEANVFTMGGYDSGFTPPGRCSSPFGITNCKDGDSTHEPY 121 NE N+F MGGYD G PPGRCS PFG NC G+ST EPY Sbjct: 183 NEPNIFAMGGYDQGIVPPGRCSYPFGF-NCHKGNSTFEPY 221 >ref|XP_002889423.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297335265|gb|EFH65682.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 493 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +2 Query: 2 NEANVFTMGGYDSGFTPPGRCSSPFGITNCKDGDSTHEPY 121 NE NVF +GGYD G TPP RCS PFG+ NC +G+S+ EPY Sbjct: 206 NEVNVFALGGYDQGITPPARCSPPFGL-NCTNGNSSIEPY 244 >ref|XP_004170794.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 10-like [Cucumis sativus] Length = 493 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/41 (65%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Frame = +2 Query: 2 NEANVFTMGGYDSGFTPPGRCSSPFG-ITNCKDGDSTHEPY 121 NE NVF +GGYD GF PPGRCS PFG NC +G+S EPY Sbjct: 191 NEPNVFVIGGYDLGFLPPGRCSFPFGKYKNCSEGNSATEPY 231