BLASTX nr result
ID: Atractylodes21_contig00055058
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00055058 (284 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003638036.1| Cysteine-rich receptor-like protein kinase [... 60 1e-07 ref|XP_003637977.1| Cysteine-rich receptor-like protein kinase [... 60 1e-07 ref|XP_003615953.1| hypothetical protein MTR_5g074450 [Medicago ... 59 4e-07 ref|XP_003608798.1| hypothetical protein MTR_4g102070 [Medicago ... 56 3e-06 >ref|XP_003638036.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] gi|355503971|gb|AES85174.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] Length = 1694 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/62 (45%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Frame = +2 Query: 77 WGNIIRSRNSINKPGVA-FEGSFRNKVGDGSDTRFWSDAWVGEGPLQDRFPRLWRLEGEK 253 W I+R R+ IN+ G F R +VGDGSDT FW D W G+ P ++RF RL+ L K Sbjct: 732 WREIVRIRDGINEDGEGWFSDCVRRRVGDGSDTDFWRDCWCGDVPFRERFRRLYNLAVNK 791 Query: 254 EV 259 + Sbjct: 792 VI 793 >ref|XP_003637977.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] gi|355503912|gb|AES85115.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] Length = 1766 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/62 (45%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Frame = +2 Query: 77 WGNIIRSRNSINKPGVA-FEGSFRNKVGDGSDTRFWSDAWVGEGPLQDRFPRLWRLEGEK 253 W I+R R+ IN+ G F R +VGDGSDT FW D W G+ P ++RF RL+ L K Sbjct: 731 WREIVRIRDGINEDGEGWFSDCVRRRVGDGSDTDFWRDCWCGDVPFRERFRRLYNLAVNK 790 Query: 254 EV 259 + Sbjct: 791 VI 792 >ref|XP_003615953.1| hypothetical protein MTR_5g074450 [Medicago truncatula] gi|355517288|gb|AES98911.1| hypothetical protein MTR_5g074450 [Medicago truncatula] Length = 530 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/62 (46%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Frame = +2 Query: 77 WGNIIRSRNSINKPGVAFEGS-FRNKVGDGSDTRFWSDAWVGEGPLQDRFPRLWRLEGEK 253 W I+R R+ I + G + GS R +VGDG+DT FW D W G PL DRF RL+ L K Sbjct: 368 WREIVRIRDGIGEGGEGWFGSCVRRRVGDGADTDFWRDCWCGNVPLCDRFSRLYDLTVNK 427 Query: 254 EV 259 + Sbjct: 428 PI 429 >ref|XP_003608798.1| hypothetical protein MTR_4g102070 [Medicago truncatula] gi|355509853|gb|AES90995.1| hypothetical protein MTR_4g102070 [Medicago truncatula] Length = 249 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/62 (45%), Positives = 39/62 (62%), Gaps = 2/62 (3%) Frame = +2 Query: 77 WGNIIRSRNSINKPGVA--FEGSFRNKVGDGSDTRFWSDAWVGEGPLQDRFPRLWRLEGE 250 W I + R+ + + G+ FE + R VGDG +T FW D W+G+ PL+ RFPRL+ L E Sbjct: 36 WNMICKVRDGVGE-GIERWFEENVRRVVGDGRNTLFWYDTWIGDTPLRLRFPRLFELVVE 94 Query: 251 KE 256 KE Sbjct: 95 KE 96