BLASTX nr result
ID: Atractylodes21_contig00054440
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00054440 (248 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptas... 57 2e-06 gb|ABN08405.1| Peptidase aspartic, active site [Medicago truncat... 56 3e-06 gb|ABN08407.1| Peptidase aspartic, active site [Medicago truncat... 56 3e-06 >gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptase); Chromo; Zinc finger, CCHC-type; Peptidase aspartic, active site; Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 1297 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/62 (41%), Positives = 40/62 (64%) Frame = +2 Query: 56 RNQGSRTLTRSE*EDRRKKGLCFKGGQQFGPSHKCPDANYRVILLAEDEESDSKGDHRLL 235 R++ L+ +E +R++KGLCFK G F P H+CPD RV++L EDEE + +G + Sbjct: 92 RDRSFTHLSYNELMERKQKGLCFKCGGPFHPMHQCPDKQLRVLVLEEDEEGEPEGKLLAV 151 Query: 236 EI 241 E+ Sbjct: 152 EV 153 >gb|ABN08405.1| Peptidase aspartic, active site [Medicago truncatula] Length = 435 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/54 (44%), Positives = 37/54 (68%) Frame = +2 Query: 56 RNQGSRTLTRSE*EDRRKKGLCFKGGQQFGPSHKCPDANYRVILLAEDEESDSK 217 R++ R+L+ E DRR+KGLCFK G + P H+CPD N V++L +D E +++ Sbjct: 43 RDKNVRSLSSQEIADRRQKGLCFKCGGPYHPRHQCPDKNLSVMVLEDDSEDENE 96 >gb|ABN08407.1| Peptidase aspartic, active site [Medicago truncatula] Length = 435 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/54 (44%), Positives = 37/54 (68%) Frame = +2 Query: 56 RNQGSRTLTRSE*EDRRKKGLCFKGGQQFGPSHKCPDANYRVILLAEDEESDSK 217 R++ R+L+ E DRR+KGLCFK G + P H+CPD N V++L +D E +++ Sbjct: 43 RDKNVRSLSSQEIADRRQKGLCFKCGGPYHPRHQCPDKNLSVMVLEDDSEDENE 96