BLASTX nr result
ID: Atractylodes21_contig00054439
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00054439 (406 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526393.1| hypothetical protein RCOM_1028290 [Ricinus c... 57 2e-06 >ref|XP_002526393.1| hypothetical protein RCOM_1028290 [Ricinus communis] gi|223534255|gb|EEF35969.1| hypothetical protein RCOM_1028290 [Ricinus communis] Length = 147 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = +2 Query: 59 HIPDEVLHNILVRLSAKPLLRFRCVSKHWNRLISDPYFMRS 181 H+P+++ +IL+RL KPLLRF+CVSK W LISDP F++S Sbjct: 3 HVPEDIAIDILLRLPVKPLLRFKCVSKTWYSLISDPCFIKS 43