BLASTX nr result
ID: Atractylodes21_contig00054284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00054284 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509470.1| conserved hypothetical protein [Ricinus comm... 67 1e-09 ref|XP_002305132.1| predicted protein [Populus trichocarpa] gi|2... 67 1e-09 ref|XP_002329825.1| predicted protein [Populus trichocarpa] gi|2... 67 2e-09 ref|XP_003543045.1| PREDICTED: uncharacterized protein LOC100804... 66 3e-09 ref|XP_003593577.1| hypothetical protein MTR_2g013690 [Medicago ... 65 4e-09 >ref|XP_002509470.1| conserved hypothetical protein [Ricinus communis] gi|223549369|gb|EEF50857.1| conserved hypothetical protein [Ricinus communis] Length = 587 Score = 67.4 bits (163), Expect = 1e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 233 YFTGYTLPPGHPCETFTMPPPPADKKRTGP 322 YF GYTLPPGHPC +FT+PPPPADKKRTGP Sbjct: 141 YFLGYTLPPGHPCNSFTLPPPPADKKRTGP 170 >ref|XP_002305132.1| predicted protein [Populus trichocarpa] gi|222848096|gb|EEE85643.1| predicted protein [Populus trichocarpa] Length = 591 Score = 67.4 bits (163), Expect = 1e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 233 YFTGYTLPPGHPCETFTMPPPPADKKRTGP 322 YF GYTLPPGHPC +FT+PPPPADKKRTGP Sbjct: 137 YFLGYTLPPGHPCNSFTLPPPPADKKRTGP 166 >ref|XP_002329825.1| predicted protein [Populus trichocarpa] gi|222870887|gb|EEF08018.1| predicted protein [Populus trichocarpa] Length = 591 Score = 66.6 bits (161), Expect = 2e-09 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +2 Query: 233 YFTGYTLPPGHPCETFTMPPPPADKKRTGP 322 YF GYTLPPGHPC FT+PPPPADKKRTGP Sbjct: 136 YFLGYTLPPGHPCNRFTLPPPPADKKRTGP 165 >ref|XP_003543045.1| PREDICTED: uncharacterized protein LOC100804922 [Glycine max] Length = 570 Score = 65.9 bits (159), Expect = 3e-09 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +2 Query: 233 YFTGYTLPPGHPCETFTMPPPPADKKRTGP 322 YF GYTLP GHPC TFT+PPPPADKKRTGP Sbjct: 130 YFLGYTLPSGHPCNTFTLPPPPADKKRTGP 159 >ref|XP_003593577.1| hypothetical protein MTR_2g013690 [Medicago truncatula] gi|355482625|gb|AES63828.1| hypothetical protein MTR_2g013690 [Medicago truncatula] Length = 570 Score = 65.5 bits (158), Expect = 4e-09 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 233 YFTGYTLPPGHPCETFTMPPPPADKKRTGP 322 YF GY LPPGHPC +FT+PPPPADKKRTGP Sbjct: 126 YFLGYNLPPGHPCNSFTLPPPPADKKRTGP 155