BLASTX nr result
ID: Atractylodes21_contig00054228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00054228 (528 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_974444.1| proline transporter 2 [Arabidopsis thaliana] gi... 65 5e-09 ref|NP_191133.1| proline transporter 2 [Arabidopsis thaliana] gi... 65 5e-09 ref|XP_002876330.1| hypothetical protein ARALYDRAFT_486008 [Arab... 65 5e-09 ref|NP_181198.1| proline transporter 3 [Arabidopsis thaliana] gi... 65 6e-09 ref|XP_002881454.1| hypothetical protein ARALYDRAFT_482636 [Arab... 65 6e-09 >ref|NP_974444.1| proline transporter 2 [Arabidopsis thaliana] gi|332645908|gb|AEE79429.1| proline transporter 2 [Arabidopsis thaliana] Length = 383 Score = 65.5 bits (158), Expect = 5e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -1 Query: 528 GVVVLLLATTISLYANSLIAKLHQFGGKMHIRYKNLERFIY 406 GVV L+LAT ISLYAN+LIAKLH+FGGK HIRY++L FIY Sbjct: 9 GVVGLILATAISLYANTLIAKLHEFGGKRHIRYRDLAGFIY 49 >ref|NP_191133.1| proline transporter 2 [Arabidopsis thaliana] gi|75220395|sp|P92962.1|PROT2_ARATH RecName: Full=Proline transporter 2; Short=AtPROT2 gi|1769903|emb|CAA65053.1| proline transporter 2 [Arabidopsis thaliana] gi|7263562|emb|CAB81599.1| proline transporter 2 [Arabidopsis thaliana] gi|19698891|gb|AAL91181.1| proline transporter 2 [Arabidopsis thaliana] gi|31376371|gb|AAP49512.1| At3g55740 [Arabidopsis thaliana] gi|332645907|gb|AEE79428.1| proline transporter 2 [Arabidopsis thaliana] Length = 439 Score = 65.5 bits (158), Expect = 5e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -1 Query: 528 GVVVLLLATTISLYANSLIAKLHQFGGKMHIRYKNLERFIY 406 GVV L+LAT ISLYAN+LIAKLH+FGGK HIRY++L FIY Sbjct: 65 GVVGLILATAISLYANTLIAKLHEFGGKRHIRYRDLAGFIY 105 >ref|XP_002876330.1| hypothetical protein ARALYDRAFT_486008 [Arabidopsis lyrata subsp. lyrata] gi|297322168|gb|EFH52589.1| hypothetical protein ARALYDRAFT_486008 [Arabidopsis lyrata subsp. lyrata] Length = 439 Score = 65.5 bits (158), Expect = 5e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -1 Query: 528 GVVVLLLATTISLYANSLIAKLHQFGGKMHIRYKNLERFIY 406 GVV L+LAT ISLYAN+LIAKLH+FGGK HIRY++L FIY Sbjct: 65 GVVGLILATAISLYANTLIAKLHEFGGKRHIRYRDLAGFIY 105 >ref|NP_181198.1| proline transporter 3 [Arabidopsis thaliana] gi|75265955|sp|Q9SJP9.1|PROT3_ARATH RecName: Full=Proline transporter 3; Short=AtPROT3 gi|4581157|gb|AAD24641.1| putative proline transporter [Arabidopsis thaliana] gi|28393251|gb|AAO42054.1| putative proline transporter [Arabidopsis thaliana] gi|330254178|gb|AEC09272.1| proline transporter 3 [Arabidopsis thaliana] Length = 436 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 528 GVVVLLLATTISLYANSLIAKLHQFGGKMHIRYKNLERFIY 406 GVV L+LAT ISLYAN+L+AKLH+FGGK HIRY++L FIY Sbjct: 62 GVVGLILATAISLYANTLVAKLHEFGGKRHIRYRDLAGFIY 102 >ref|XP_002881454.1| hypothetical protein ARALYDRAFT_482636 [Arabidopsis lyrata subsp. lyrata] gi|297327293|gb|EFH57713.1| hypothetical protein ARALYDRAFT_482636 [Arabidopsis lyrata subsp. lyrata] Length = 436 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 528 GVVVLLLATTISLYANSLIAKLHQFGGKMHIRYKNLERFIY 406 GVV L+LAT ISLYAN+L+AKLH+FGGK HIRY++L FIY Sbjct: 62 GVVGLILATAISLYANTLVAKLHEFGGKRHIRYRDLAGFIY 102