BLASTX nr result
ID: Atractylodes21_contig00054188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00054188 (211 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67762.1| hypothetical protein VITISV_040650 [Vitis vinifera] 62 5e-08 emb|CAB10526.1| retrotransposon like protein [Arabidopsis thalia... 62 6e-08 gb|AAD19784.1| putative retroelement pol polyprotein [Arabidopsi... 61 8e-08 gb|AAG51258.1|AC025782_3 Ty1/copia-element polyprotein [Arabidop... 60 2e-07 gb|AAT40486.1| putative polyprotein [Solanum demissum] 60 2e-07 >emb|CAN67762.1| hypothetical protein VITISV_040650 [Vitis vinifera] Length = 1316 Score = 62.0 bits (149), Expect = 5e-08 Identities = 32/62 (51%), Positives = 39/62 (62%) Frame = -1 Query: 211 HILDIVRTLMILAQCPERFWGEDAFTAIYTINRHPTSVLDNKSLYESLYGMFYAYDILKV 32 HIL+I RTL A P FWGE TA Y INR PT +LD K+ YE L+G Y+ L+V Sbjct: 554 HILNIARTLRFQACLPIDFWGECVLTAAYLINRTPTPILDGKTPYEILFGEKPNYEHLRV 613 Query: 31 WG 26 +G Sbjct: 614 FG 615 >emb|CAB10526.1| retrotransposon like protein [Arabidopsis thaliana] gi|7268497|emb|CAB78748.1| retrotransposon like protein [Arabidopsis thaliana] Length = 1433 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/62 (46%), Positives = 40/62 (64%) Frame = -1 Query: 211 HILDIVRTLMILAQCPERFWGEDAFTAIYTINRHPTSVLDNKSLYESLYGMFYAYDILKV 32 HIL++ R L+ + P FWG+ TA++ INR PT VL+NKS YE L + AY+ LK Sbjct: 707 HILNVARALLFQSNIPLEFWGDCVLTAVFLINRLPTPVLNNKSPYEKLKNIPPAYESLKT 766 Query: 31 WG 26 +G Sbjct: 767 FG 768 >gb|AAD19784.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 1501 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/62 (45%), Positives = 39/62 (62%) Frame = -1 Query: 211 HILDIVRTLMILAQCPERFWGEDAFTAIYTINRHPTSVLDNKSLYESLYGMFYAYDILKV 32 HIL++ R L+ A P +FWGE TA Y INR P+S+L ++ YE L+G Y L+V Sbjct: 692 HILNVARALLFQASLPIKFWGESILTAAYLINRTPSSILSGRTPYEVLHGSKPVYSQLRV 751 Query: 31 WG 26 +G Sbjct: 752 FG 753 >gb|AAG51258.1|AC025782_3 Ty1/copia-element polyprotein [Arabidopsis thaliana] Length = 1152 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/62 (45%), Positives = 39/62 (62%) Frame = -1 Query: 211 HILDIVRTLMILAQCPERFWGEDAFTAIYTINRHPTSVLDNKSLYESLYGMFYAYDILKV 32 HIL++ R+L+ A+ P FW E TA Y INR PT +LD K+ Y+ LY +Y L+V Sbjct: 679 HILNVARSLLFQAELPISFWEESVLTAAYLINRTPTPILDGKTPYKILYSQPPSYASLRV 738 Query: 31 WG 26 +G Sbjct: 739 FG 740 >gb|AAT40486.1| putative polyprotein [Solanum demissum] Length = 1065 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/62 (46%), Positives = 38/62 (61%) Frame = -1 Query: 211 HILDIVRTLMILAQCPERFWGEDAFTAIYTINRHPTSVLDNKSLYESLYGMFYAYDILKV 32 HIL++ R L A P FWGE A+Y INR PT +L+ K+ YE L+G +Y LKV Sbjct: 506 HILNVTRALRFQANLPISFWGEYVLPAVYLINRTPTLILNGKTPYEVLFGKEPSYKPLKV 565 Query: 31 WG 26 +G Sbjct: 566 FG 567