BLASTX nr result
ID: Atractylodes21_contig00053697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00053697 (212 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519607.1| serine-threonine protein kinase, plant-type,... 61 1e-07 ref|XP_002270021.2| PREDICTED: probable L-type lectin-domain con... 59 3e-07 emb|CBI23109.3| unnamed protein product [Vitis vinifera] 58 7e-07 >ref|XP_002519607.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223541197|gb|EEF42752.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Length = 681 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = +3 Query: 3 SMAEVVEYVSFEREVPELPPSRPMALFPYTSTTGLCSNSYMCASFK 140 SM EV+ ++S +R +PELP SRP+ALFPY S TGLC+ Y C+ FK Sbjct: 637 SMEEVIAFLSLDRPIPELPSSRPIALFPYNSATGLCT-GYSCSPFK 681 >ref|XP_002270021.2| PREDICTED: probable L-type lectin-domain containing receptor kinase S.7-like [Vitis vinifera] Length = 671 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = +3 Query: 3 SMAEVVEYVSFEREVPELPPSRPMALFPYTSTTGLCSNSYMCASFK 140 SM EVV +++ +R VP+LPP RP++LFPY+STTGLCS + C+ FK Sbjct: 627 SMEEVVGFLAMDRPVPQLPPCRPISLFPYSSTTGLCSGN-PCSLFK 671 >emb|CBI23109.3| unnamed protein product [Vitis vinifera] Length = 606 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/48 (56%), Positives = 37/48 (77%) Frame = +3 Query: 3 SMAEVVEYVSFEREVPELPPSRPMALFPYTSTTGLCSNSYMCASFK*F 146 SM EVV +++ +R VP+LPP RP++LFPY+STTGLCS + C+ F F Sbjct: 549 SMEEVVGFLAMDRPVPQLPPCRPISLFPYSSTTGLCSGN-PCSLFNRF 595