BLASTX nr result
ID: Atractylodes21_contig00052976
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00052976 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003529001.1| PREDICTED: ubiquitin-like-conjugating enzyme... 57 1e-06 >ref|XP_003529001.1| PREDICTED: ubiquitin-like-conjugating enzyme ATG10-like [Glycine max] Length = 238 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = +2 Query: 131 VSDQATCDGSLSLSDFRIAANAFAEKWKKFNSAFPEWLWIDC 256 V D DG+LS SDF ++A+ F+EKWK+FN +FP W WI C Sbjct: 7 VKDIIAWDGTLSSSDFSLSAHTFSEKWKRFNPSFPPWQWIPC 48