BLASTX nr result
ID: Atractylodes21_contig00052761
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00052761 (379 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA42470.1| TPA: putative vesicle-associated membrane protei... 59 5e-07 tpg|DAA42471.1| TPA: putative vesicle-associated membrane protei... 57 2e-06 gb|AAF40460.1|AC004809_18 Strong similarity to the synaptobrevin... 56 3e-06 gb|AAY41423.1| putative synaptobrevin-like protein [Ipomoea bata... 56 3e-06 ref|XP_002879406.1| hypothetical protein ARALYDRAFT_482195 [Arab... 55 5e-06 >tpg|DAA42470.1| TPA: putative vesicle-associated membrane protein family protein [Zea mays] Length = 176 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 379 MENIEKVLDRGEKIEVLVDKTENLRSQVSEC 287 MENIEKVLDRGEKIE+LVDKTENLRSQV+ C Sbjct: 146 MENIEKVLDRGEKIELLVDKTENLRSQVTGC 176 >tpg|DAA42471.1| TPA: putative vesicle-associated membrane protein family protein [Zea mays] Length = 189 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -1 Query: 379 MENIEKVLDRGEKIEVLVDKTENLRSQVS 293 MENIEKVLDRGEKIE+LVDKTENLRSQ+S Sbjct: 146 MENIEKVLDRGEKIELLVDKTENLRSQIS 174 >gb|AAF40460.1|AC004809_18 Strong similarity to the synaptobrevin homolog F25I18.14 gi|2924792 from A. thaliana on BAC gb|AC002334 [Arabidopsis thaliana] Length = 229 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -1 Query: 379 MENIEKVLDRGEKIEVLVDKTENLRSQVS 293 MENIEKVLDRGEKIE+LVDKTENLRSQV+ Sbjct: 146 MENIEKVLDRGEKIELLVDKTENLRSQVN 174 >gb|AAY41423.1| putative synaptobrevin-like protein [Ipomoea batatas] Length = 87 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 379 MENIEKVLDRGEKIEVLVDKTENLRSQVSECKCE 278 MENIEKVLDRGEKIE+LVDKTENLRSQ + + + Sbjct: 13 MENIEKVLDRGEKIEILVDKTENLRSQAQDFRTQ 46 >ref|XP_002879406.1| hypothetical protein ARALYDRAFT_482195 [Arabidopsis lyrata subsp. lyrata] gi|297325245|gb|EFH55665.1| hypothetical protein ARALYDRAFT_482195 [Arabidopsis lyrata subsp. lyrata] Length = 220 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 379 MENIEKVLDRGEKIEVLVDKTENLRSQVSECKCE 278 MENIEKVLDRGEKIE+LVDKTENLRSQ + + + Sbjct: 146 MENIEKVLDRGEKIELLVDKTENLRSQAQDFRAQ 179