BLASTX nr result
ID: Atractylodes21_contig00052516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00052516 (262 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAH36876.1| xyloglucan endotransglucosylase/hydrolase [Rosa ... 61 1e-07 gb|ACD03229.1| xyloglucan endotransglucosylase/hydrolase 5 [Malu... 57 2e-06 gb|ACD03213.1| xyloglucan endotransglucosylase/hydrolase 3 [Acti... 55 5e-06 >dbj|BAH36876.1| xyloglucan endotransglucosylase/hydrolase [Rosa hybrid cultivar] Length = 302 Score = 60.8 bits (146), Expect = 1e-07 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +1 Query: 115 AARFDDLFHPYWASDHFTFEGQTVNMKLDNFSG 213 +A+FD LF PYWASDHFT+EG+ ++MKLDNFSG Sbjct: 30 SAKFDQLFQPYWASDHFTYEGELLHMKLDNFSG 62 >gb|ACD03229.1| xyloglucan endotransglucosylase/hydrolase 5 [Malus x domestica] Length = 296 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = +1 Query: 115 AARFDDLFHPYWASDHFTFEGQTVNMKLDNFSGKKSQN 228 +A+FD+LF P WA DHFT+EG+ ++MKLDNFSG Q+ Sbjct: 27 SAKFDELFQPTWAFDHFTYEGEQIHMKLDNFSGAGFQS 64 >gb|ACD03213.1| xyloglucan endotransglucosylase/hydrolase 3 [Actinidia eriantha] Length = 290 Score = 55.5 bits (132), Expect = 5e-06 Identities = 21/33 (63%), Positives = 29/33 (87%) Frame = +1 Query: 115 AARFDDLFHPYWASDHFTFEGQTVNMKLDNFSG 213 +++FD+LF P WA DHFT+EG+T+ MKLDN+SG Sbjct: 22 SSKFDELFQPSWALDHFTYEGETLKMKLDNYSG 54