BLASTX nr result
ID: Atractylodes21_contig00051916
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00051916 (219 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273438.2| PREDICTED: zinc finger CCCH domain-containin... 89 5e-16 ref|XP_003554702.1| PREDICTED: zinc finger CCCH domain-containin... 85 5e-15 ref|XP_002324006.1| predicted protein [Populus trichocarpa] gi|2... 84 1e-14 ref|XP_003524556.1| PREDICTED: zinc finger CCCH domain-containin... 82 6e-14 ref|XP_002300018.1| predicted protein [Populus trichocarpa] gi|2... 81 8e-14 >ref|XP_002273438.2| PREDICTED: zinc finger CCCH domain-containing protein 41-like [Vitis vinifera] Length = 948 Score = 88.6 bits (218), Expect = 5e-16 Identities = 44/64 (68%), Positives = 52/64 (81%) Frame = -3 Query: 193 NSDSSLKLQSGNGRMLRKPSQKAQRTLFVNGFPRQNNIRESLLSHFKKFGEVIHIYIPLN 14 N D S + QS R +RKPSQKA RTLFVNG P++NN +E+LLSHF+KFGEVI IYIPLN Sbjct: 466 NVDLSSRTQSDAMRNIRKPSQKALRTLFVNGIPQKNNRKEALLSHFRKFGEVIDIYIPLN 525 Query: 13 SQRA 2 S+RA Sbjct: 526 SERA 529 >ref|XP_003554702.1| PREDICTED: zinc finger CCCH domain-containing protein 41-like [Glycine max] Length = 945 Score = 85.1 bits (209), Expect = 5e-15 Identities = 42/62 (67%), Positives = 52/62 (83%) Frame = -3 Query: 187 DSSLKLQSGNGRMLRKPSQKAQRTLFVNGFPRQNNIRESLLSHFKKFGEVIHIYIPLNSQ 8 ++SLK Q+ + R +RK SQKA TLFVNG P++NN RE+LL+HFKKFGEVI IYIPLNS+ Sbjct: 456 EASLKAQTDSMRNIRKSSQKALCTLFVNGIPQKNNKREALLAHFKKFGEVIDIYIPLNSE 515 Query: 7 RA 2 RA Sbjct: 516 RA 517 >ref|XP_002324006.1| predicted protein [Populus trichocarpa] gi|222867008|gb|EEF04139.1| predicted protein [Populus trichocarpa] Length = 964 Score = 84.0 bits (206), Expect = 1e-14 Identities = 42/62 (67%), Positives = 49/62 (79%) Frame = -3 Query: 187 DSSLKLQSGNGRMLRKPSQKAQRTLFVNGFPRQNNIRESLLSHFKKFGEVIHIYIPLNSQ 8 DS K QS R KPSQKA RTLFVNG P+++N RE+LLSHF+KFGEVI IYIPLN++ Sbjct: 457 DSPAKTQSNTMRHTPKPSQKALRTLFVNGIPQKSNKREALLSHFQKFGEVIDIYIPLNTE 516 Query: 7 RA 2 RA Sbjct: 517 RA 518 >ref|XP_003524556.1| PREDICTED: zinc finger CCCH domain-containing protein 41-like [Glycine max] Length = 922 Score = 81.6 bits (200), Expect = 6e-14 Identities = 41/62 (66%), Positives = 51/62 (82%) Frame = -3 Query: 187 DSSLKLQSGNGRMLRKPSQKAQRTLFVNGFPRQNNIRESLLSHFKKFGEVIHIYIPLNSQ 8 ++SLK Q+ + R +RK SQKA TLFVNG P++ N RE+LL+HFKKFGEVI IYIPLNS+ Sbjct: 456 EASLKAQTDSMRNIRKSSQKAFCTLFVNGIPQKYNKREALLAHFKKFGEVIDIYIPLNSE 515 Query: 7 RA 2 RA Sbjct: 516 RA 517 >ref|XP_002300018.1| predicted protein [Populus trichocarpa] gi|222847276|gb|EEE84823.1| predicted protein [Populus trichocarpa] Length = 981 Score = 81.3 bits (199), Expect = 8e-14 Identities = 41/62 (66%), Positives = 48/62 (77%) Frame = -3 Query: 187 DSSLKLQSGNGRMLRKPSQKAQRTLFVNGFPRQNNIRESLLSHFKKFGEVIHIYIPLNSQ 8 DS K+ S R RK SQKA RTLFVNG P ++N R++LLSHF+KFGEVI IYIPLNS+ Sbjct: 466 DSPAKIHSDTMRHTRKLSQKALRTLFVNGIPHKSNKRDALLSHFQKFGEVIDIYIPLNSE 525 Query: 7 RA 2 RA Sbjct: 526 RA 527