BLASTX nr result
ID: Atractylodes21_contig00049998
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00049998 (446 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN08132.1| Putative non-LTR retroelement reverse transcripta... 62 6e-08 >gb|ABN08132.1| Putative non-LTR retroelement reverse transcriptase, related [Medicago truncatula] Length = 532 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/116 (25%), Positives = 59/116 (50%), Gaps = 1/116 (0%) Frame = +3 Query: 3 LFVRCSVARKILLEIGSWWGLSCVGISNIQS-LLNWGVTFNFKGDRLKAFSGVVYSYLWL 179 LF+ C + + L + +W G+S V S ++ + + F + ++Y+W+ Sbjct: 415 LFLDCRIPTMVWLHVQNWIGISTVSPSQMREHFTQFTLMAGMPRSSHSVFKVIWFAYVWV 474 Query: 180 VWKLRNGKVFKGADGEKVAMMYDQIQAMAFFWVKNRSKSCNLAHRWSDWVQDPVSC 347 +WK RN +VF G ++++++++ +F W+K + S N + DW Q P+ C Sbjct: 475 IWKDRNNRVFNNT-GSNHSVLFEKVKLNSFLWLKAKCPSLNFGYH--DWWQHPLPC 527