BLASTX nr result
ID: Atractylodes21_contig00049800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00049800 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN08620.1| hAT family dimerisation domain, , putative [Medic... 59 4e-07 emb|CAN61798.1| hypothetical protein VITISV_044291 [Vitis vinifera] 56 3e-06 >gb|ABN08620.1| hAT family dimerisation domain, , putative [Medicago truncatula] Length = 110 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/52 (48%), Positives = 34/52 (65%) Frame = +2 Query: 62 LALMADSMRSKYDKYWGKIECLNPFLLVAILLDPRYKEPFLNVCFELMCGDK 217 LA M M+ KY+KYWGKIE +N + ++LDPRYK ++ CF M GD+ Sbjct: 7 LASMGSDMKQKYNKYWGKIENINKLIYFGVILDPRYKFSYVEWCFNDMYGDQ 58 >emb|CAN61798.1| hypothetical protein VITISV_044291 [Vitis vinifera] Length = 563 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/56 (44%), Positives = 37/56 (66%) Frame = +2 Query: 53 DHKLALMADSMRSKYDKYWGKIECLNPFLLVAILLDPRYKEPFLNVCFELMCGDKV 220 D L+ MA +M++KYDKYWG ++ N L V ++LDPRYK F+ CF+ + +V Sbjct: 323 DLLLSDMAQNMKAKYDKYWGNLKRSNLLLYVVVVLDPRYKLKFVQFCFDQLYDKEV 378