BLASTX nr result
ID: Atractylodes21_contig00049751
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00049751 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003598243.1| hypothetical protein MTR_3g008890 [Medicago ... 61 8e-08 >ref|XP_003598243.1| hypothetical protein MTR_3g008890 [Medicago truncatula] gi|355487291|gb|AES68494.1| hypothetical protein MTR_3g008890 [Medicago truncatula] Length = 148 Score = 61.2 bits (147), Expect = 8e-08 Identities = 35/51 (68%), Positives = 38/51 (74%), Gaps = 3/51 (5%) Frame = -3 Query: 269 KTKEFSLESLITRLRIEEEARKQDRKEEVLVVSNSTKRS---NDSLKPKPK 126 KTKEFSLESLITRLRIEEEARKQD KEEV VSN+ ++ LKP K Sbjct: 92 KTKEFSLESLITRLRIEEEARKQDLKEEVFDVSNNNTKNKFVGAVLKPNAK 142