BLASTX nr result
ID: Atractylodes21_contig00049639
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00049639 (203 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006291801.1| ccmFc gene product (mitochondrion) [Daucus c... 57 2e-06 ref|YP_173470.1| cytochrome c maturation protein CcmFc [Nicotian... 56 3e-06 dbj|BAD83536.2| cytochrome c maturation protein CcmFc (mitochond... 56 3e-06 gb|AFR34309.1| cytochrome c biogenesis FC (mitochondrion) [Glyci... 56 3e-06 sp|P93286.2|CCMF_ARATH RecName: Full=Putative cytochrome c bioge... 56 3e-06 >ref|YP_006291801.1| ccmFc gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374081937|gb|AEY81129.1| cytochrome c biogenesis FC (mitochondrion) [Daucus carota subsp. sativus] Length = 450 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 16 HFRKSIRSTDGAKSGVLVRASRPILLPDIIG 108 H +K IRSTDGAKSGVLVRASRPILLPDIIG Sbjct: 60 HSKKFIRSTDGAKSGVLVRASRPILLPDIIG 90 >ref|YP_173470.1| cytochrome c maturation protein CcmFc [Nicotiana tabacum] Length = 438 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +1 Query: 16 HFRKSIRSTDGAKSGVLVRASRPILLPDIIG 108 H RK IRS DGAKSGVLVRASRPILLPDIIG Sbjct: 60 HSRKFIRSADGAKSGVLVRASRPILLPDIIG 90 >dbj|BAD83536.2| cytochrome c maturation protein CcmFc (mitochondrion) [Nicotiana tabacum] Length = 438 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +1 Query: 16 HFRKSIRSTDGAKSGVLVRASRPILLPDIIG 108 H RK IRS DGAKSGVLVRASRPILLPDIIG Sbjct: 60 HSRKFIRSADGAKSGVLVRASRPILLPDIIG 90 >gb|AFR34309.1| cytochrome c biogenesis FC (mitochondrion) [Glycine max] Length = 443 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +1 Query: 16 HFRKSIRSTDGAKSGVLVRASRPILLPDIIG 108 H RK IRS DGAKSGVLVRASRPILLPDIIG Sbjct: 60 HSRKFIRSMDGAKSGVLVRASRPILLPDIIG 90 >sp|P93286.2|CCMF_ARATH RecName: Full=Putative cytochrome c biogenesis ccmF-like mitochondrial protein Length = 442 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +1 Query: 16 HFRKSIRSTDGAKSGVLVRASRPILLPDIIG 108 H RK IRS DGAKSGVLVRASRPILLPDIIG Sbjct: 60 HSRKIIRSMDGAKSGVLVRASRPILLPDIIG 90