BLASTX nr result
ID: Atractylodes21_contig00049597
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00049597 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002877320.1| hypothetical protein ARALYDRAFT_905504 [Arab... 63 3e-08 ref|XP_002870660.1| hypothetical protein ARALYDRAFT_493877 [Arab... 63 3e-08 gb|AAM53283.1| unknown protein [Arabidopsis thaliana] 62 6e-08 ref|NP_566806.1| putative metal-nicotianamine transporter YSL6 [... 60 2e-07 dbj|BAB09702.1| unnamed protein product [Arabidopsis thaliana] 60 2e-07 >ref|XP_002877320.1| hypothetical protein ARALYDRAFT_905504 [Arabidopsis lyrata subsp. lyrata] gi|297323158|gb|EFH53579.1| hypothetical protein ARALYDRAFT_905504 [Arabidopsis lyrata subsp. lyrata] Length = 430 Score = 62.8 bits (151), Expect = 3e-08 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 SCFKWFFGSCGDLCGFDHFPSLGLTLFKNT 92 SCFKWFF GD CGFDHFP+LGLTLFKNT Sbjct: 88 SCFKWFFSGIGDACGFDHFPTLGLTLFKNT 117 >ref|XP_002870660.1| hypothetical protein ARALYDRAFT_493877 [Arabidopsis lyrata subsp. lyrata] gi|297316496|gb|EFH46919.1| hypothetical protein ARALYDRAFT_493877 [Arabidopsis lyrata subsp. lyrata] Length = 670 Score = 62.8 bits (151), Expect = 3e-08 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 SCFKWFFGSCGDLCGFDHFPSLGLTLFKNT 92 SCFKWFF GD CGFDHFP+LGLTLFKNT Sbjct: 225 SCFKWFFSGIGDACGFDHFPTLGLTLFKNT 254 >gb|AAM53283.1| unknown protein [Arabidopsis thaliana] Length = 676 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +3 Query: 3 SCFKWFFGSCGDLCGFDHFPSLGLTLFKNT*VCSFR 110 SCFKWFF GD CGFD+FP+LGLTLFKNT FR Sbjct: 228 SCFKWFFSGIGDACGFDNFPTLGLTLFKNTFYFDFR 263 >ref|NP_566806.1| putative metal-nicotianamine transporter YSL6 [Arabidopsis thaliana] gi|160359042|sp|Q6R3K6.2|YSL6_ARATH RecName: Full=Probable metal-nicotianamine transporter YSL6; AltName: Full=Protein YELLOW STRIPE LIKE 6; Short=AtYSL6 gi|9279625|dbj|BAB01083.1| unnamed protein product [Arabidopsis thaliana] gi|332643734|gb|AEE77255.1| putative metal-nicotianamine transporter YSL6 [Arabidopsis thaliana] Length = 676 Score = 60.1 bits (144), Expect = 2e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 3 SCFKWFFGSCGDLCGFDHFPSLGLTLFKNT 92 SCFKWFF GD CGFD+FP+LGLTLFKNT Sbjct: 228 SCFKWFFSGIGDACGFDNFPTLGLTLFKNT 257 >dbj|BAB09702.1| unnamed protein product [Arabidopsis thaliana] Length = 664 Score = 60.1 bits (144), Expect = 2e-07 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +3 Query: 3 SCFKWFFGSCGDLCGFDHFPSLGLTLFKNT 92 SCFKWFF G CGFDHFP+LGLTLFKNT Sbjct: 225 SCFKWFFSGIGGACGFDHFPTLGLTLFKNT 254