BLASTX nr result
ID: Atractylodes21_contig00049568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00049568 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534699.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002534699.1| conserved hypothetical protein [Ricinus communis] gi|223524744|gb|EEF27685.1| conserved hypothetical protein [Ricinus communis] Length = 112 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 151 FSLQTMLEYNGHKRNLKKLQIFLETSKKLIVMAK 50 F+ ++ YNGHKRNLKKL+IFLETSKKLIVMAK Sbjct: 78 FANDVLVLYNGHKRNLKKLKIFLETSKKLIVMAK 111