BLASTX nr result
ID: Atractylodes21_contig00049515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00049515 (385 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78683.1| hypothetical protein VITISV_043889 [Vitis vinifera] 56 3e-06 >emb|CAN78683.1| hypothetical protein VITISV_043889 [Vitis vinifera] Length = 364 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/61 (44%), Positives = 35/61 (57%), Gaps = 2/61 (3%) Frame = +3 Query: 123 FRVTFLSCQSYPSGWSIKSIKLCSYWLVA--WYGVVSHLEACDGNNSYCHCHDSCDFVLT 296 F + FL P W + S+ + +A WYG+V HLE+CDGN SYC CH+S VL Sbjct: 249 FFLYFLFVIFNPGWWEVDSLLDMRCYDIAGWWYGIVGHLESCDGNESYCRCHNSETVVLE 308 Query: 297 F 299 F Sbjct: 309 F 309