BLASTX nr result
ID: Atractylodes21_contig00049496
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00049496 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003525761.1| PREDICTED: probable inactive leucine-rich re... 68 1e-11 emb|CAN69961.1| hypothetical protein VITISV_008739 [Vitis vinifera] 72 5e-11 ref|XP_002298609.1| predicted protein [Populus trichocarpa] gi|2... 72 6e-11 ref|XP_002509547.1| leucine-rich repeat protein, putative [Ricin... 71 8e-11 ref|XP_002511211.1| leucine-rich repeat protein, putative [Ricin... 70 2e-10 >ref|XP_003525761.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770-like [Glycine max] Length = 764 Score = 68.2 bits (165), Expect(2) = 1e-11 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 5/54 (9%) Frame = +1 Query: 73 TPPTALFT-----YLNLASNMLSGPLPNSIKCGNKLGFIDISSNTFTDKLPSCL 219 TPP+ LF+ YLNLASN LSG LP+ + CG+KLGF+DISSN + LPSCL Sbjct: 295 TPPSTLFSLPKISYLNLASNALSGALPDKLSCGSKLGFVDISSNKLSGGLPSCL 348 Score = 25.8 bits (55), Expect(2) = 1e-11 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 Query: 3 PKDFGTLNQLHHLD 44 PK FG L+QL HLD Sbjct: 273 PKQFGELDQLQHLD 286 >emb|CAN69961.1| hypothetical protein VITISV_008739 [Vitis vinifera] Length = 773 Score = 72.0 bits (175), Expect = 5e-11 Identities = 35/55 (63%), Positives = 42/55 (76%), Gaps = 5/55 (9%) Frame = +1 Query: 70 GTPPTALFT-----YLNLASNMLSGPLPNSIKCGNKLGFIDISSNTFTDKLPSCL 219 GTPP+ALF+ YLNLASNMLSG LP+ + CG++LGF+DISSN LPSCL Sbjct: 294 GTPPSALFSMANISYLNLASNMLSGSLPDGLSCGDELGFVDISSNKLMGVLPSCL 348 >ref|XP_002298609.1| predicted protein [Populus trichocarpa] gi|222845867|gb|EEE83414.1| predicted protein [Populus trichocarpa] Length = 673 Score = 71.6 bits (174), Expect = 6e-11 Identities = 34/55 (61%), Positives = 42/55 (76%), Gaps = 5/55 (9%) Frame = +1 Query: 70 GTPPTALFT-----YLNLASNMLSGPLPNSIKCGNKLGFIDISSNTFTDKLPSCL 219 GTPP+++F+ YLNLASNMLSG LPN + CG+KLGF+D+SSN LPSCL Sbjct: 205 GTPPSSMFSLPNISYLNLASNMLSGSLPNHLLCGSKLGFVDLSSNKLIGGLPSCL 259 >ref|XP_002509547.1| leucine-rich repeat protein, putative [Ricinus communis] gi|223549446|gb|EEF50934.1| leucine-rich repeat protein, putative [Ricinus communis] Length = 769 Score = 71.2 bits (173), Expect = 8e-11 Identities = 34/55 (61%), Positives = 42/55 (76%), Gaps = 5/55 (9%) Frame = +1 Query: 70 GTPPTALFT-----YLNLASNMLSGPLPNSIKCGNKLGFIDISSNTFTDKLPSCL 219 GTPP++LF+ YLNLASNMLSG LP+ + CG+ LGF+DIS+N F LPSCL Sbjct: 294 GTPPSSLFSLPNIRYLNLASNMLSGSLPDHLSCGSNLGFVDISTNKFIGGLPSCL 348 >ref|XP_002511211.1| leucine-rich repeat protein, putative [Ricinus communis] gi|223550326|gb|EEF51813.1| leucine-rich repeat protein, putative [Ricinus communis] Length = 802 Score = 69.7 bits (169), Expect = 2e-10 Identities = 34/55 (61%), Positives = 40/55 (72%), Gaps = 5/55 (9%) Frame = +1 Query: 70 GTPPTALFT-----YLNLASNMLSGPLPNSIKCGNKLGFIDISSNTFTDKLPSCL 219 G PP LF+ YLNLASNMLSG LPN + CG+KL F+DIS+N+FT LP CL Sbjct: 374 GKPPATLFSLPNISYLNLASNMLSGSLPNHLSCGSKLQFVDISNNSFTGGLPYCL 428