BLASTX nr result
ID: Atractylodes21_contig00049396
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00049396 (396 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280156.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 emb|CBI26947.3| unnamed protein product [Vitis vinifera] 69 3e-10 ref|XP_003545661.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-09 ref|XP_003543970.1| PREDICTED: pentatricopeptide repeat-containi... 63 2e-08 ref|XP_002526312.1| pentatricopeptide repeat-containing protein,... 63 2e-08 >ref|XP_002280156.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Vitis vinifera] Length = 718 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = +2 Query: 2 GNWSEALRLYTEMLERGIKPDSCTHSALLKQLGMNSKARAVHYLEHVV 145 GNW EAL LY +ML+RG++PDSCTHSALLKQLG + K +AV LE ++ Sbjct: 668 GNWQEALSLYKQMLDRGVQPDSCTHSALLKQLGKDCKLQAVRQLESLL 715 >emb|CBI26947.3| unnamed protein product [Vitis vinifera] Length = 1078 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +2 Query: 2 GNWSEALRLYTEMLERGIKPDSCTHSALLKQLGMNSKARAVH 127 GNW EAL LY +ML+RG++PDSCTHSALLKQLG + K +AVH Sbjct: 668 GNWQEALSLYKQMLDRGVQPDSCTHSALLKQLGKDCKLQAVH 709 >ref|XP_003545661.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Glycine max] Length = 675 Score = 67.0 bits (162), Expect = 1e-09 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = +2 Query: 2 GNWSEALRLYTEMLERGIKPDSCTHSALLKQLGMNSKARAVHYLEHVVLGNE 157 G+W EALRLY +ML+R I+PDSCTHSALLK L + K+ V +LE+V+ E Sbjct: 624 GHWQEALRLYKDMLDREIQPDSCTHSALLKHLNKDYKSHVVRHLENVIAAGE 675 >ref|XP_003543970.1| PREDICTED: pentatricopeptide repeat-containing protein At1g22960, mitochondrial-like [Glycine max] Length = 687 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/52 (53%), Positives = 37/52 (71%) Frame = +2 Query: 2 GNWSEALRLYTEMLERGIKPDSCTHSALLKQLGMNSKARAVHYLEHVVLGNE 157 G+W EALRLY +ML+R I+PDSCTH +LLK L + K V +LE+V+ E Sbjct: 636 GHWQEALRLYKDMLDREIQPDSCTHRSLLKHLNKDYKLHVVRHLENVIAAGE 687 >ref|XP_002526312.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223534393|gb|EEF36101.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 729 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/59 (47%), Positives = 41/59 (69%) Frame = +2 Query: 2 GNWSEALRLYTEMLERGIKPDSCTHSALLKQLGMNSKARAVHYLEHVVLGNEDVGEAKS 178 G W EALRLY +ML + I+PDSCTH ALLK+L + K +AV ++E ++L + +A + Sbjct: 671 GKWQEALRLYAQMLGKRIRPDSCTHGALLKKLDKDYKVQAVQFIESLILDGDRTIDANT 729