BLASTX nr result
ID: Atractylodes21_contig00049262
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00049262 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266054.1| PREDICTED: vinorine synthase-like [Vitis vin... 55 6e-06 >ref|XP_002266054.1| PREDICTED: vinorine synthase-like [Vitis vinifera] Length = 436 Score = 55.1 bits (131), Expect = 6e-06 Identities = 32/90 (35%), Positives = 49/90 (54%), Gaps = 6/90 (6%) Frame = -2 Query: 253 KNVTKKLSFSDSAISNFKKKARLNGRNGAP------KWSKVQSVSALLVKALIDVDRSKH 92 K VT + F + IS+ K KA+ N + P + S+V+ V+AL+ +ALI V + KH Sbjct: 210 KFVTMRFVFDGANISSLKAKAKANSKTSTPGPSLKHQVSRVEVVTALIWRALIGVSQGKH 269 Query: 91 KYPRDFVVVQAINLRERTASLIPKHSCGNL 2 R + V + NLR + +P + CGNL Sbjct: 270 GRLRTSLAVHSANLRGKIVPALPDNCCGNL 299