BLASTX nr result
ID: Atractylodes21_contig00049208
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00049208 (370 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521753.1| hydrolase, putative [Ricinus communis] gi|22... 57 2e-06 >ref|XP_002521753.1| hydrolase, putative [Ricinus communis] gi|223538966|gb|EEF40563.1| hydrolase, putative [Ricinus communis] Length = 423 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = +1 Query: 1 HRLQGEKSLNHHYAVFKVVLPEE*IP*SDSDKTVNDAE 114 +RLQGEKSLNHHYAVF+VVLPEE + ++SD+ V+DA+ Sbjct: 386 YRLQGEKSLNHHYAVFRVVLPEEVLNMAESDERVDDAD 423