BLASTX nr result
ID: Atractylodes21_contig00049064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00049064 (396 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511875.1| cytochrome P450, putative [Ricinus communis]... 74 2e-11 ref|XP_004138498.1| PREDICTED: cytochrome P450 86A2-like [Cucumi... 65 7e-09 ref|XP_003627566.1| Cytochrome P450 fatty acid omega-hydroxylase... 64 1e-08 gb|ABC68403.1| cytochrome P450 monooxygenase CYP86A24 [Glycine max] 64 1e-08 ref|XP_003532839.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P... 64 1e-08 >ref|XP_002511875.1| cytochrome P450, putative [Ricinus communis] gi|223549055|gb|EEF50544.1| cytochrome P450, putative [Ricinus communis] Length = 522 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -2 Query: 125 YNMDVSIALLLFTAVTASLLWFTFISRSLKGPRVWPIFGSL 3 Y MDVS AL+LF+AVTA LLWFTFISRSLKGPRVWP+ GSL Sbjct: 6 YTMDVSTALMLFSAVTAYLLWFTFISRSLKGPRVWPLLGSL 46 >ref|XP_004138498.1| PREDICTED: cytochrome P450 86A2-like [Cucumis sativus] gi|449495315|ref|XP_004159797.1| PREDICTED: cytochrome P450 86A2-like [Cucumis sativus] Length = 547 Score = 64.7 bits (156), Expect = 7e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 119 MDVSIALLLFTAVTASLLWFTFISRSLKGPRVWPIFGSL 3 MDV AL++ TAVTA LLWFTFISRSLKGP++WP+ GSL Sbjct: 1 MDVGFALVIVTAVTAYLLWFTFISRSLKGPQMWPLLGSL 39 >ref|XP_003627566.1| Cytochrome P450 fatty acid omega-hydroxylase [Medicago truncatula] gi|355521588|gb|AET02042.1| Cytochrome P450 fatty acid omega-hydroxylase [Medicago truncatula] Length = 540 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 119 MDVSIALLLFTAVTASLLWFTFISRSLKGPRVWPIFGSL 3 M+ ALLL TA+TA LLWFTFISRSL+GPRVWP+ GSL Sbjct: 1 METCTALLLLTAITAYLLWFTFISRSLRGPRVWPLLGSL 39 >gb|ABC68403.1| cytochrome P450 monooxygenase CYP86A24 [Glycine max] Length = 528 Score = 63.9 bits (154), Expect = 1e-08 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = -2 Query: 119 MDVSIALLLFTAVTASLLWFTFISRSLKGPRVWPIFGSL 3 MD S AL++ +A+ A L+WFTF++RSLKGPRVWP+FGSL Sbjct: 1 MDASTALMILSAIAAYLIWFTFVTRSLKGPRVWPLFGSL 39 >ref|XP_003532839.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 86A2-like [Glycine max] Length = 528 Score = 63.9 bits (154), Expect = 1e-08 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = -2 Query: 119 MDVSIALLLFTAVTASLLWFTFISRSLKGPRVWPIFGSL 3 MD S AL++ +A+ A L+WFTF++RSLKGPRVWP+FGSL Sbjct: 1 MDASTALMILSAIAAYLIWFTFVTRSLKGPRVWPLFGSL 39