BLASTX nr result
ID: Atractylodes21_contig00049034
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00049034 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003519715.1| PREDICTED: BTB/POZ domain-containing protein... 70 2e-10 ref|XP_002530034.1| signal transducer, putative [Ricinus communi... 70 2e-10 ref|XP_002311763.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 ref|XP_004172442.1| PREDICTED: BTB/POZ domain-containing protein... 69 4e-10 ref|XP_004135274.1| PREDICTED: BTB/POZ domain-containing protein... 69 4e-10 >ref|XP_003519715.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Glycine max] Length = 636 Score = 70.1 bits (170), Expect = 2e-10 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +3 Query: 99 MKFMKLGSRPDTFYSANGVRSISSEVRCDLVIQVNETRYLLHK 227 MKFMKLGSRPDTFY+A VRS+SSEV DL+IQV +RYLLHK Sbjct: 1 MKFMKLGSRPDTFYTAEAVRSVSSEVSSDLIIQVKGSRYLLHK 43 >ref|XP_002530034.1| signal transducer, putative [Ricinus communis] gi|223530450|gb|EEF32334.1| signal transducer, putative [Ricinus communis] Length = 631 Score = 70.1 bits (170), Expect = 2e-10 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +3 Query: 99 MKFMKLGSRPDTFYSANGVRSISSEVRCDLVIQVNETRYLLHK 227 MKFMKLGSRPDTFY+A VRS+SSEV DL+IQV +RYLLHK Sbjct: 1 MKFMKLGSRPDTFYTAEAVRSVSSEVSSDLIIQVKGSRYLLHK 43 >ref|XP_002311763.1| predicted protein [Populus trichocarpa] gi|222851583|gb|EEE89130.1| predicted protein [Populus trichocarpa] Length = 628 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +3 Query: 99 MKFMKLGSRPDTFYSANGVRSISSEVRCDLVIQVNETRYLLHK 227 MKFMKLGSRPDTFY+A VRS+SSEV DL++QV +RYLLHK Sbjct: 1 MKFMKLGSRPDTFYTAQAVRSVSSEVSSDLIVQVKGSRYLLHK 43 >ref|XP_004172442.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Cucumis sativus] Length = 627 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +3 Query: 99 MKFMKLGSRPDTFYSANGVRSISSEVRCDLVIQVNETRYLLHK 227 MKFMKLGSRPDTFY+A VRS++SEV DL+IQV +RYLLHK Sbjct: 1 MKFMKLGSRPDTFYTAEAVRSVTSEVSSDLIIQVKGSRYLLHK 43 >ref|XP_004135274.1| PREDICTED: BTB/POZ domain-containing protein At1g67900-like [Cucumis sativus] Length = 627 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +3 Query: 99 MKFMKLGSRPDTFYSANGVRSISSEVRCDLVIQVNETRYLLHK 227 MKFMKLGSRPDTFY+A VRS++SEV DL+IQV +RYLLHK Sbjct: 1 MKFMKLGSRPDTFYTAEAVRSVTSEVSSDLIIQVKGSRYLLHK 43