BLASTX nr result
ID: Atractylodes21_contig00049022
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00049022 (465 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316368.1| predicted protein [Populus trichocarpa] gi|2... 69 3e-10 gb|ABK93261.1| unknown [Populus trichocarpa] 69 3e-10 emb|CAN75444.1| hypothetical protein VITISV_019659 [Vitis vinifera] 69 3e-10 ref|XP_002532755.1| conserved hypothetical protein [Ricinus comm... 69 4e-10 ref|XP_002311091.1| predicted protein [Populus trichocarpa] gi|2... 69 4e-10 >ref|XP_002316368.1| predicted protein [Populus trichocarpa] gi|222865408|gb|EEF02539.1| predicted protein [Populus trichocarpa] Length = 322 Score = 69.3 bits (168), Expect = 3e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 370 QCVLVKGWKGTSWSFPRGKKNKDEEDDACAIR 465 +C+LVKGWKGTSWSFPRGKKNKDEED ACAIR Sbjct: 121 RCLLVKGWKGTSWSFPRGKKNKDEEDHACAIR 152 >gb|ABK93261.1| unknown [Populus trichocarpa] Length = 322 Score = 69.3 bits (168), Expect = 3e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 370 QCVLVKGWKGTSWSFPRGKKNKDEEDDACAIR 465 +C+LVKGWKGTSWSFPRGKKNKDEED ACAIR Sbjct: 121 RCLLVKGWKGTSWSFPRGKKNKDEEDHACAIR 152 >emb|CAN75444.1| hypothetical protein VITISV_019659 [Vitis vinifera] Length = 318 Score = 69.3 bits (168), Expect = 3e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 370 QCVLVKGWKGTSWSFPRGKKNKDEEDDACAIR 465 QC+LVKGWKGTSWSFPRGKKNKDEED CAIR Sbjct: 117 QCLLVKGWKGTSWSFPRGKKNKDEEDHTCAIR 148 >ref|XP_002532755.1| conserved hypothetical protein [Ricinus communis] gi|223527506|gb|EEF29632.1| conserved hypothetical protein [Ricinus communis] Length = 316 Score = 68.9 bits (167), Expect = 4e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 373 CVLVKGWKGTSWSFPRGKKNKDEEDDACAIR 465 C+LVKGWKGTSWSFPRGKKNKDEED ACAIR Sbjct: 116 CLLVKGWKGTSWSFPRGKKNKDEEDHACAIR 146 >ref|XP_002311091.1| predicted protein [Populus trichocarpa] gi|222850911|gb|EEE88458.1| predicted protein [Populus trichocarpa] Length = 322 Score = 68.9 bits (167), Expect = 4e-10 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 370 QCVLVKGWKGTSWSFPRGKKNKDEEDDACAIR 465 +C+LVKGWKGTSWSFPRGKKNKDEED ACA+R Sbjct: 121 RCLLVKGWKGTSWSFPRGKKNKDEEDHACAVR 152