BLASTX nr result
ID: Atractylodes21_contig00047717
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00047717 (224 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285230.1| PREDICTED: probable NAD(P)H-dependent oxidor... 56 3e-06 >ref|XP_002285230.1| PREDICTED: probable NAD(P)H-dependent oxidoreductase 1 [Vitis vinifera] Length = 316 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/49 (55%), Positives = 38/49 (77%) Frame = +2 Query: 2 KQNLEIFNWSLTDEELNKIGQISQQKHIYLTGYMVTEPNDVVAEIDSEL 148 K+NLEIF+WSLT+EELNKI Q+ Q+K + L + P+D+V EID+E+ Sbjct: 270 KENLEIFDWSLTNEELNKIDQLPQRKRVLLAPLL--GPHDLVLEIDAEI 316