BLASTX nr result
ID: Atractylodes21_contig00046270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00046270 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABC94480.1| putative flavonoid 3'-hydroxylase cytochrome P450... 71 8e-11 >gb|ABC94480.1| putative flavonoid 3'-hydroxylase cytochrome P450 [Artemisia annua] Length = 528 Score = 71.2 bits (173), Expect = 8e-11 Identities = 28/57 (49%), Positives = 41/57 (71%) Frame = -3 Query: 202 MVISDLGDNIYHTIFSYWSWWFEVSNKQDELARAILTFSISILMLLWCKWLFLSSKK 32 ++++D D IY+T+ +YWSWW+EV N+ D +AR ILT + IL+LLW KW +KK Sbjct: 2 ILVTDFKDKIYYTMINYWSWWWEVDNESDNVARTILTILVPILVLLWYKWTVSYTKK 58