BLASTX nr result
ID: Atractylodes21_contig00046238
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00046238 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003610646.1| hypothetical protein MTR_5g005410 [Medicago ... 85 7e-15 ref|XP_003630318.1| Auxilin-like protein [Medicago truncatula] g... 81 8e-14 ref|XP_003630317.1| Auxilin-like protein [Medicago truncatula] g... 81 8e-14 ref|XP_003597432.1| hypothetical protein MTR_2g097990 [Medicago ... 80 2e-13 ref|XP_003593688.1| hypothetical protein MTR_2g015020 [Medicago ... 79 4e-13 >ref|XP_003610646.1| hypothetical protein MTR_5g005410 [Medicago truncatula] gi|355511981|gb|AES93604.1| hypothetical protein MTR_5g005410 [Medicago truncatula] Length = 389 Score = 84.7 bits (208), Expect = 7e-15 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +1 Query: 193 SPHAQDFLLAIPIDGLGQHMSPVEYRTILKYRLMIPLFPVD 315 +PHAQDFLLAIPIDGLGQHMSP+EYRTIL+YRLMIPLFP+D Sbjct: 244 APHAQDFLLAIPIDGLGQHMSPIEYRTILRYRLMIPLFPID 284 >ref|XP_003630318.1| Auxilin-like protein [Medicago truncatula] gi|355524340|gb|AET04794.1| Auxilin-like protein [Medicago truncatula] Length = 949 Score = 81.3 bits (199), Expect = 8e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 193 SPHAQDFLLAIPIDGLGQHMSPVEYRTILKYRLMIPLFPVD 315 +PHAQDFLLAIPIDGLGQHMS VEYRTIL+YRLMIPLFP+D Sbjct: 47 APHAQDFLLAIPIDGLGQHMSLVEYRTILRYRLMIPLFPID 87 >ref|XP_003630317.1| Auxilin-like protein [Medicago truncatula] gi|355524339|gb|AET04793.1| Auxilin-like protein [Medicago truncatula] Length = 1017 Score = 81.3 bits (199), Expect = 8e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 193 SPHAQDFLLAIPIDGLGQHMSPVEYRTILKYRLMIPLFPVD 315 +PHAQDFLLAIPIDGLGQHMS VEYRTIL+YRLMIPLFP+D Sbjct: 47 APHAQDFLLAIPIDGLGQHMSLVEYRTILRYRLMIPLFPID 87 >ref|XP_003597432.1| hypothetical protein MTR_2g097990 [Medicago truncatula] gi|355486480|gb|AES67683.1| hypothetical protein MTR_2g097990 [Medicago truncatula] Length = 289 Score = 80.1 bits (196), Expect = 2e-13 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +1 Query: 199 HAQDFLLAIPIDGLGQHMSPVEYRTILKYRLMIPLFPVD 315 HAQ+FLLAIPIDGLGQHMSPVEYRTIL+YRLMIPLFP+D Sbjct: 71 HAQNFLLAIPIDGLGQHMSPVEYRTILRYRLMIPLFPID 109 >ref|XP_003593688.1| hypothetical protein MTR_2g015020 [Medicago truncatula] gi|355482736|gb|AES63939.1| hypothetical protein MTR_2g015020 [Medicago truncatula] Length = 239 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +1 Query: 199 HAQDFLLAIPIDGLGQHMSPVEYRTILKYRLMIPLFPVD 315 HAQDFLLAIPID LGQHMSPVEYRTIL+YRLMIPLFP+D Sbjct: 7 HAQDFLLAIPIDELGQHMSPVEYRTILRYRLMIPLFPID 45