BLASTX nr result
ID: Atractylodes21_contig00046187
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00046187 (541 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004172502.1| PREDICTED: uncharacterized mitochondrial pro... 38 3e-06 >ref|XP_004172502.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like, partial [Cucumis sativus] Length = 296 Score = 38.1 bits (87), Expect(2) = 3e-06 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = +1 Query: 31 TATHIAHNDMFHG*TKHIEIDSHFI 105 +A IAHND+FH TKHIE D HF+ Sbjct: 224 SAIQIAHNDVFHERTKHIENDCHFV 248 Score = 38.1 bits (87), Expect(2) = 3e-06 Identities = 21/45 (46%), Positives = 29/45 (64%), Gaps = 4/45 (8%) Frame = +3 Query: 111 HVVGNTVR----SSIDQTTSVFNKALLSGCFSSLVHKLELVSRNP 233 H+ NT+ S+IDQ +FNKAL S F+ L+HKL++VS P Sbjct: 251 HLQSNTLHLQSISTIDQPADIFNKALHSPRFTLLLHKLKVVSTLP 295